PDB entry 5h0n

View 5h0n on RCSB PDB site
Description: crystal structure of hiv-1 fusion inhibitor mt-wq-idl bound to gp41 nhr
Deposited on 2016-10-06, released 2016-11-02
The last revision was dated 2017-11-22, with a file datestamp of 2017-11-17.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: N/A
AEROSPACI score: 0.17 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: HIV-1 gp41 NHR
    Species: Human immunodeficiency virus 1, synthetic [TaxId:11676]
    Database cross-references and differences (RAF-indexed):
    • PDB 5H0N
  • Chain 'B':
    Compound: HIV-1 fusion inhibitor MT-WQ-IDL
    Species: Human immunodeficiency virus 1, synthetic [TaxId:11676]
    Database cross-references and differences (RAF-indexed):
    • PDB 5H0N (0-30)
  • Chain 'C':
    Compound: HIV-1 gp41 NHR
    Species: Human immunodeficiency virus 1, synthetic [TaxId:11676]
    Database cross-references and differences (RAF-indexed):
    • PDB 5H0N
  • Chain 'D':
    Compound: HIV-1 fusion inhibitor MT-WQ-IDL
    Species: Human immunodeficiency virus 1, synthetic [TaxId:11676]
    Database cross-references and differences (RAF-indexed):
    • PDB 5H0N (0-End)
  • Chain 'E':
    Compound: HIV-1 gp41 NHR
    Species: Human immunodeficiency virus 1, synthetic [TaxId:11676]
    Database cross-references and differences (RAF-indexed):
    • PDB 5H0N
  • Chain 'F':
    Compound: HIV-1 fusion inhibitor MT-WQ-IDL
    Species: Human immunodeficiency virus 1, synthetic [TaxId:11676]
    Database cross-references and differences (RAF-indexed):
    • PDB 5H0N (0-End)
  • Chain 'G':
    Compound: HIV-1 gp41 NHR
    Species: Human immunodeficiency virus 1, synthetic [TaxId:11676]
    Database cross-references and differences (RAF-indexed):
    • PDB 5H0N
  • Chain 'H':
    Compound: HIV-1 fusion inhibitor MT-WQ-IDL
    Species: Human immunodeficiency virus 1, synthetic [TaxId:11676]
    Database cross-references and differences (RAF-indexed):
    • PDB 5H0N (0-End)
  • Chain 'I':
    Compound: HIV-1 gp41 NHR
    Species: Human immunodeficiency virus 1, synthetic [TaxId:11676]
    Database cross-references and differences (RAF-indexed):
    • PDB 5H0N
  • Chain 'J':
    Compound: HIV-1 fusion inhibitor MT-WQ-IDL
    Species: Human immunodeficiency virus 1, synthetic [TaxId:11676]
    Database cross-references and differences (RAF-indexed):
    • PDB 5H0N (0-30)
  • Chain 'K':
    Compound: HIV-1 gp41 NHR
    Species: Human immunodeficiency virus 1, synthetic [TaxId:11676]
    Database cross-references and differences (RAF-indexed):
    • PDB 5H0N
  • Chain 'L':
    Compound: HIV-1 fusion inhibitor MT-WQ-IDL
    Species: Human immunodeficiency virus 1, synthetic [TaxId:11676]
    Database cross-references and differences (RAF-indexed):
    • PDB 5H0N (0-End)
  • Heterogens: HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >5h0nA (A:)
    tltvqarqllsgivqqqnnllraieaqqhllqltvwgikqlqaril
    

    Sequence, based on observed residues (ATOM records):
    >5h0nA (A:)
    arqllsgivqqqnnllraieaqqhllqltvwgikqlqari
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records:
    >5h0nB (B:)
    mtweewdkkieeytkkieelikksqnqqidl
    

  • Chain 'C':
    Sequence, based on SEQRES records:
    >5h0nC (C:)
    tltvqarqllsgivqqqnnllraieaqqhllqltvwgikqlqaril
    

    Sequence, based on observed residues (ATOM records):
    >5h0nC (C:)
    vqarqllsgivqqqnnllraieaqqhllqltvwgikqlqari
    

  • Chain 'D':
    Sequence, based on SEQRES records:
    >5h0nD (D:)
    mtweewdkkieeytkkieelikksqnqqidl
    

    Sequence, based on observed residues (ATOM records):
    >5h0nD (D:)
    mtweewdkkieeytkkieelikksqnqqid
    

  • Chain 'E':
    Sequence, based on SEQRES records:
    >5h0nE (E:)
    tltvqarqllsgivqqqnnllraieaqqhllqltvwgikqlqaril
    

    Sequence, based on observed residues (ATOM records):
    >5h0nE (E:)
    tvqarqllsgivqqqnnllraieaqqhllqltvwgikqlqari
    

  • Chain 'F':
    Sequence, based on SEQRES records:
    >5h0nF (F:)
    mtweewdkkieeytkkieelikksqnqqidl
    

    Sequence, based on observed residues (ATOM records):
    >5h0nF (F:)
    mtweewdkkieeytkkieelikksqnqqid
    

  • Chain 'G':
    Sequence, based on SEQRES records:
    >5h0nG (G:)
    tltvqarqllsgivqqqnnllraieaqqhllqltvwgikqlqaril
    

    Sequence, based on observed residues (ATOM records):
    >5h0nG (G:)
    ltvqarqllsgivqqqnnllraieaqqhllqltvwgikqlqari
    

  • Chain 'H':
    Sequence, based on SEQRES records:
    >5h0nH (H:)
    mtweewdkkieeytkkieelikksqnqqidl
    

    Sequence, based on observed residues (ATOM records):
    >5h0nH (H:)
    mtweewdkkieeytkkieelikksqnqqid
    

  • Chain 'I':
    Sequence, based on SEQRES records:
    >5h0nI (I:)
    tltvqarqllsgivqqqnnllraieaqqhllqltvwgikqlqaril
    

    Sequence, based on observed residues (ATOM records):
    >5h0nI (I:)
    ltvqarqllsgivqqqnnllraieaqqhllqltvwgikqlqari
    

  • Chain 'J':
    Sequence; same for both SEQRES and ATOM records:
    >5h0nJ (J:)
    mtweewdkkieeytkkieelikksqnqqidl
    

  • Chain 'K':
    Sequence, based on SEQRES records:
    >5h0nK (K:)
    tltvqarqllsgivqqqnnllraieaqqhllqltvwgikqlqaril
    

    Sequence, based on observed residues (ATOM records):
    >5h0nK (K:)
    tvqarqllsgivqqqnnllraieaqqhllqltvwgikqlqari
    

  • Chain 'L':
    Sequence, based on SEQRES records:
    >5h0nL (L:)
    mtweewdkkieeytkkieelikksqnqqidl
    

    Sequence, based on observed residues (ATOM records):
    >5h0nL (L:)
    mtweewdkkieeytkkieelikksqnqqid