PDB entry 5h0i

View 5h0i on RCSB PDB site
Description: name to be released when published
Deposited on 2016-10-04, released 2017-03-29
The last revision was dated 2017-05-03, with a file datestamp of 2017-04-28.
Experiment type: XRAY
Resolution: 2.56 Å
R-factor: N/A
AEROSPACI score: 0.19 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Asparaginyl endopeptidase
    Species: Oldenlandia affinis [TaxId:60225]
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: Asparaginyl endopeptidase
    Species: Oldenlandia affinis [TaxId:60225]
    Database cross-references and differences (RAF-indexed):
  • Heterogens: HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >5h0iA (A:)
    gdylhlpsevsrffrpqetnddhgedsvgtrwavliagskgyanyrhqagvchayqilkr
    gglkdenivvfmyddiaynesnprpgviinsphgsdvyagvpkdytgeevnaknflaail
    gnksaitggsgkvvdsgpndhifiyytdhgaagvigmpskpylyadelndalkkkhasgt
    ykslvfyleacesgsmfegilpedlniyaltstnttesswcyycpaqenppppeynvclg
    dlfsvawledsdvqnswyetlnqqyhhvdkrishashatqygnlklgeeglfvymgsnpa
    ndnytsldgnaltpssivvnqrdadllhlwekfrkapegsarkeeaqtqifkamshrvhi
    dssikligkllfgiekcteilnavrpagqplvddwaclrslvgtfethcgslseygmrht
    rtianicnagiseeqmaeaasqacasip
    

    Sequence, based on observed residues (ATOM records):
    >5h0iA (A:)
    gtrwavliagskgyanyrhqagvchayqilkrgglkdenivvfmyddiaynesnprpgvi
    insphgsdvyagvpkdytgeevnaknflaailgnksaitggsgkvvdsgpndhifiyytd
    hgaagvigmpskpylyadelndalkkkhasgtykslvfyleacesgsmfegilpedlniy
    altstnttesswcyycpaqenppppeynvclgdlfsvawledsdvqnswyetlnqqyhhv
    dkrishashatqygnlklgeeglfvymgsnpvvnqrdadllhlwekfrkapegsarkeea
    qtqifkamshrvhidssikligkllfgiekcteilnavrpagqplvddwaclrslvgtfe
    thcgslseygmrhtrtianicnagiseeqmaeaasqacas
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >5h0iB (B:)
    gdylhlpsevsrffrpqetnddhgedsvgtrwavliagskgyanyrhqagvchayqilkr
    gglkdenivvfmyddiaynesnprpgviinsphgsdvyagvpkdytgeevnaknflaail
    gnksaitggsgkvvdsgpndhifiyytdhgaagvigmpskpylyadelndalkkkhasgt
    ykslvfyleacesgsmfegilpedlniyaltstnttesswcyycpaqenppppeynvclg
    dlfsvawledsdvqnswyetlnqqyhhvdkrishashatqygnlklgeeglfvymgsnpa
    ndnytsldgnaltpssivvnqrdadllhlwekfrkapegsarkeeaqtqifkamshrvhi
    dssikligkllfgiekcteilnavrpagqplvddwaclrslvgtfethcgslseygmrht
    rtianicnagiseeqmaeaasqacasip
    

    Sequence, based on observed residues (ATOM records):
    >5h0iB (B:)
    vgtrwavliagskgyanyrhqagvchayqilkrgglkdenivvfmyddiaynesnprpgv
    iinsphgsdvyagvpkdytgeevnaknflaailgnksaitggsgkvvdsgpndhifiyyt
    dhgaagvigmpskpylyadelndalkkkhasgtykslvfyleacesgsmfegilpedlni
    yaltstnttesswcyycpaqenppppeynvclgdlfsvawledsdvqnswyetlnqqyhh
    vdkrishashatqygnlklgeeglfvymgsivvnqrdadllhlwekfrkapegsarkeea
    qtqifkamshrvhidssikligkllfgiekcteilnavrpagqplvddwaclrslvgtfe
    thcgslseygmrhtrtianicnagiseeqmaeaasqacas