PDB entry 5h08

View 5h08 on RCSB PDB site
Description: Human PTPRZ D1 domain complexed with NAZ2329
Class: hydrolase/hydrolase inhibitor
Keywords: Protein Tyrosine Phosphatase, HYDROLASE, HYDROLASE-HYDROLASE INHIBITOR complex
Deposited on 2016-10-04, released 2017-07-26
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-08-16, with a file datestamp of 2017-08-11.
Experiment type: XRAY
Resolution: 2.53 Å
R-factor: N/A
AEROSPACI score: 0.19 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Receptor-type tyrosine-protein phosphatase zeta
    Species: Homo sapiens [TaxId:9606]
    Gene: PTPRZ1, HTPZP2, PTPRZ, PTPRZ2, PTPZ
    Database cross-references and differences (RAF-indexed):
    • Uniprot P23471 (2-End)
      • expression tag (0-1)
    Domains in SCOPe 2.07: d5h08a1, d5h08a2
  • Heterogens: 7WL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5h08A (A:)
    gpaipikhfpkhvadlhassgfteefeevqsctvdlgitadssnhpdnkhknryinivay
    dhsrvklaqlaekdgkltdyinanyvdgynrpkayiaaqgplkstaedfwrmiwehnvev
    ivmitnlvekgrrkcdqywpadgseeygnflvtqksvqvlayytvrnftlrntkikkgsq
    kgrpsgrvvtqyhytqwpdmgvpeyslpvltfvrkaayakrhavgpvvvhcsagvgrtgt
    yivldsmlqqiqhegtvnifgflkhirsqrnylvqteeqyvfihdtlveailsketev
    

    Sequence, based on observed residues (ATOM records): (download)
    >5h08A (A:)
    gpaipikhfpkhvadlhassgfteefeevqsctvdlgitadssnhpdnkhknryinivay
    dhsrvklaqlaekdgkltdyinanyvdgynrpkayiaaqgplkstaedfwrmiwehnvev
    ivmitnlvekgrrkcdqywpadgseeygnflvtqksvqvlayytvrnftlrntkirvvtq
    yhytqwpdmgvpeyslpvltfvrkaayakrhavgpvvvhcsagvgrtgtyivldsmlqqi
    qhegtvnifgflkhirsqrnylvqteeqyvfihdtlveails