PDB entry 5h04

View 5h04 on RCSB PDB site
Description: Crystal structure of an ADP-ribosylating toxin BECa of a novel binary enterotoxin of C. perfringens with NADH
Class: toxin
Keywords: toxin, ADP-ribosyltransferase
Deposited on 2016-10-03, released 2016-11-02
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-02-26, with a file datestamp of 2020-02-21.
Experiment type: XRAY
Resolution: 1.83 Å
R-factor: N/A
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Binary enterotoxin of Clostridium perfringens component a
    Species: Clostridium perfringens [TaxId:1502]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d5h04a1, d5h04a2
  • Heterogens: NAI, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5h04A (A:)
    mlddnrpmdfakdknsatlwakkrkqvwlnnlskaestsinnyiknsseinsysikkkfa
    ldnyegietlnedlknistavkksmltkplyvyyyeandkfgfnqnlessldsniideea
    innfakkisdtnfiqdgfkdvtmtepdinsklpilvhlklptntpaasygndeenlrvli
    dqgyslkatglsivtikgkqyakvdadlikqlnfendvisasqwgeenyapwlkeltsne
    lrdinnylgggytainkylldgtigentskedleekisnissalkkrkipediityrrmg
    pnefgldlnspdydfnkvenvskfkekwlgktipvktfisttvlsnnisafakrklilrl
    hlpngsnaayvsvaegykneyevlidhgysykidniteyydesslggktnkliidatli