PDB entry 5h03

View 5h03 on RCSB PDB site
Description: Crystal structure of an ADP-ribosylating toxin BECa from C. perfringens
Class: toxin
Keywords: Toxin, ADP-ribosyltransferase
Deposited on 2016-10-03, released 2016-11-02
The last revision prior to the SCOPe 2.07 freeze date was dated 2016-11-09, with a file datestamp of 2016-11-04.
Experiment type: XRAY
Resolution: 1.89 Å
R-factor: N/A
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Binary enterotoxin of Clostridium perfringens component a
    Species: Clostridium perfringens [TaxId:1502]
    Gene: becA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5h03a1, d5h03a2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5h03A (A:)
    mlddnrpmdfakdknsatlwakkrkqvwlnnlskaestsinnyiknsseinsysikkkfa
    ldnyegietlnedlknistavkksmltkplyvyyyeandkfgfnqnlessldsniideea
    innfakkisdtnfiqdgfkdvtmtepdinsklpilvhlklptntpaasygndeenlrvli
    dqgyslkatglsivtikgkqyakvdadlikqlnfendvisasqwgeenyapwlkeltsne
    lrdinnylgggytainkylldgtigentskedleekisnissalkkrkipediityrrmg
    pnefgldlnspdydfnkvenvskfkekwlgktipvktfisttvlsnnisafakrklilrl
    hlpngsnaayvsvaegykneyevlidhgysykidniteyydesslggktnkliidatli
    

    Sequence, based on observed residues (ATOM records): (download)
    >5h03A (A:)
    ddnrpmdfakdknsatlwakkrkqvwlnnlskaestsinnyiknsseinsysikkkfald
    nyegietlnedlknistavkksmltkplyvyyyeandkfgfnqnlessldsniideeain
    nfakkisdtnfiqdgfkdvtmtepdinsklpilvhlklptntpaasygndeenlrvlidq
    gyslkatglsivtikgkqyakvdadlikqlnfendvisasqwgeenyapwlkeltsnelr
    dinnylgggytainkylldgtigentskedleekisnissalkkrkipediityrrmgpn
    efgldlnspdydfnkvenvskfkekwlgktipvktfisttvlsnnisafakrklilrlhl
    pngsnaayvsvaegykneyevlidhgysykidniteyydesslggktnkliidatli