PDB entry 5gzp

View 5gzp on RCSB PDB site
Description: y74cox mutant of plasmodium falciparum triosephosphate isomerase
Class: isomerase
Keywords: tim barrel, beta-alpha barrels, isomerase, glycolysis, covalent dimer
Deposited on 2016-09-30, released 2017-10-04
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-04, with a file datestamp of 2017-09-29.
Experiment type: XRAY
Resolution: 2.03 Å
R-factor: N/A
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: triosephosphate isomerase
    Species: Plasmodium falciparum [TaxId:5833]
    Gene: tpi
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q07412 (Start-247)
      • engineered mutation (73)
      • engineered mutation (162)
    Domains in SCOPe 2.07: d5gzpa_
  • Chain 'B':
    Compound: triosephosphate isomerase
    Species: Plasmodium falciparum [TaxId:5833]
    Gene: tpi
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q07412 (Start-247)
      • engineered mutation (73)
      • engineered mutation (162)
    Domains in SCOPe 2.07: d5gzpb_
  • Heterogens: PGA, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5gzpA (A:)
    markyfvaanwkcngtlesiksltnsfnnldfdpskldvvvfpvsvhydhtrkllqskfs
    tgiqnvskfgngsctgevsaeiakdlnieyviighferrkyfhetdedvreklqaslknn
    lkavvcfgesleqreqnktievitkqvkafvdlidnfdnvilvyeplwaigtgktatpeq
    aqlvhkeirkivkdtcgekqanqirilyggsvntencssliqqedidgflvgnaslkesf
    vdiiksam
    

    Sequence, based on observed residues (ATOM records): (download)
    >5gzpA (A:)
    arkyfvaanwkcngtlesiksltnsfnnldfdpskldvvvfpvsvhydhtrkllqskfst
    giqnvskfgngsctgevsaeiakdlnieyviighferrkyfhetdedvreklqaslknnl
    kavvcfgesleqreqnktievitkqvkafvdlidnfdnvilvyeplwaigtgktatpeqa
    qlvhkeirkivkdtcgekqanqirilyggsvntencssliqqedidgflvgnaslkesfv
    diiksam
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5gzpB (B:)
    markyfvaanwkcngtlesiksltnsfnnldfdpskldvvvfpvsvhydhtrkllqskfs
    tgiqnvskfgngsctgevsaeiakdlnieyviighferrkyfhetdedvreklqaslknn
    lkavvcfgesleqreqnktievitkqvkafvdlidnfdnvilvyeplwaigtgktatpeq
    aqlvhkeirkivkdtcgekqanqirilyggsvntencssliqqedidgflvgnaslkesf
    vdiiksam
    

    Sequence, based on observed residues (ATOM records): (download)
    >5gzpB (B:)
    arkyfvaanwkcngtlesiksltnsfnnldfdpskldvvvfpvsvhydhtrkllqskfst
    giqnvskfgngsctgevsaeiakdlnieyviighferrkyfhetdedvreklqaslknnl
    kavvcfgesleqreqnktievitkqvkafvdlidnfdnvilvyeplwaigtgktatpeqa
    qlvhkeirkivkdtcgekqanqirilyggsvntencssliqqedidgflvgnaslkesfv
    diiksam