PDB entry 5gzl

View 5gzl on RCSB PDB site
Description: cyclodeaminase_pa
Deposited on 2016-09-29, released 2018-01-17
The last revision was dated 2018-01-17, with a file datestamp of 2018-01-12.
No data on structure quality are available

Chains and heterogens:

  • Chain 'A':
    Compound: Lysine cyclodeaminase
    Species: Streptomyces pristinaespiralis [TaxId:38300]
    Gene: pipA, SPRI_0308, SPRI_7045
    Database cross-references and differences (RAF-indexed):
    • Uniprot D9UBW0 (4-End)
      • expression tag (0-3)
  • Chain 'B':
    Compound: Lysine cyclodeaminase
    Species: Streptomyces pristinaespiralis [TaxId:38300]
    Gene: pipA, SPRI_0308, SPRI_7045
    Database cross-references and differences (RAF-indexed):
  • Heterogens: NAD, LYS, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >5gzlA (A:)
    rgshmetwvlgrrdvaevvaavgrdelmrriidrltgglaeigrgerhlsplrgglerse
    pvpgiwewmphrepgdhitlktvgyspanparfglptilgtvaryddttgaltalmdgvl
    ltalrtgaasavasrllarpdshtlgligtgaqavtqlhalslvlplqralvwdtdpahr
    esfarraaftgvsveiaepariaaeadvistatsvavgqgpvlpdtgvrehlhinavgad
    lvgktelplgllerafvtadhpeqalregecqqlsadrlgpqlahlcadpaaaagrqdtl
    svfdstgfafedalamevfleaaaerdlgirvgiehhpgdaldpyalqplplplaapah
    

    Sequence, based on observed residues (ATOM records):
    >5gzlA (A:)
    rgshmetwvlgrrdvaevvaavgrdelmrriidrltgglaeigrgerhlsplrgglerse
    pvpgiwewmphrepgdhitlktvgyspanparfglptilgtvaryddttgaltalmdgvl
    ltalrtgaasavasrllarpdshtlgligtgaqavtqlhalslvlplqralvwdtdpahr
    esfarraaftgvsveiaepariaaeadvistatsvavgqgpvlpdtgvrehlhinavgad
    lvgktelplgllerafvtadhpeqalregecqqlsadrlgpqlahlcadpaaaagrqdtl
    svfdstgfafedalamevfleaaaerdlgirvgiehhpgdaldpyalqplplplaap
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >5gzlB (B:)
    rgshmetwvlgrrdvaevvaavgrdelmrriidrltgglaeigrgerhlsplrgglerse
    pvpgiwewmphrepgdhitlktvgyspanparfglptilgtvaryddttgaltalmdgvl
    ltalrtgaasavasrllarpdshtlgligtgaqavtqlhalslvlplqralvwdtdpahr
    esfarraaftgvsveiaepariaaeadvistatsvavgqgpvlpdtgvrehlhinavgad
    lvgktelplgllerafvtadhpeqalregecqqlsadrlgpqlahlcadpaaaagrqdtl
    svfdstgfafedalamevfleaaaerdlgirvgiehhpgdaldpyalqplplplaapah
    

    Sequence, based on observed residues (ATOM records):
    >5gzlB (B:)
    metwvlgrrdvaevvaavgrdelmrriidrltgglaeigrgerhlsplrgglersepvpg
    iwewmphrepgdhitlktvgyspanparfglptilgtvaryddttgaltalmdgvlltal
    rtgaasavasrllarpdshtlgligtgaqavtqlhalslvlplqralvwdtdpahresfa
    rraaftgvsveiaepariaaeadvistatsvavgqgpvlpdtgvrehlhinavgadlvgk
    telplgllerafvtadhpeqalregecqqlsadrlgpqlahlcadpaaaagrqdtlsvfd
    stgfafedalamevfleaaaerdlgirvgiehhpgdaldpyalqplp