PDB entry 5gzg

View 5gzg on RCSB PDB site
Description: Galectin-8 N-terminal domain carbohydrate recognition domain
Class: sugar binding protein
Keywords: Galectin-8 N-terminal domain carbohydrate recognition domain, SUGAR BINDING PROTEIN
Deposited on 2016-09-28, released 2016-12-21
The last revision prior to the SCOPe 2.07 freeze date was dated 2016-12-21, with a file datestamp of 2016-12-16.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Galectin-8
    Species: Homo sapiens [TaxId:9606]
    Gene: LGALS8
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5gzga_
  • Heterogens: LAT, NA, NI, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5gzgA (A:)
    gshmmlslnnlqniiynpvipfvgtipdqldpgtlivirghvpsdadrfqvdlqngssmk
    pradvafhfnprfkragcivcntlinekwgreeitydtpfkreksfeivimvlkdkfqva
    vngkhtllyghrigpekidtlgiygkvnihsigfsfssdlqstqasslelteisrenvpk
    sgtpqlrlp
    

    Sequence, based on observed residues (ATOM records): (download)
    >5gzgA (A:)
    lnnlqniiynpvipfvgtipdqldpgtlivirghvpsdadrfqvdlqngssmkpradvaf
    hfnprfkragcivcntlinekwgreeitydtpfkreksfeivimvlkdkfqvavngkhtl
    lyghrigpekidtlgiygkvnihsigfsf