PDB entry 5gzc

View 5gzc on RCSB PDB site
Description: Crystal structure of Galectin-8 N-CRD with part of linker
Class: sugar binding protein
Keywords: Galectin-8 N-CRD structure, SUGAR BINDING PROTEIN
Deposited on 2016-09-28, released 2016-12-21
The last revision prior to the SCOPe 2.07 freeze date was dated 2016-12-21, with a file datestamp of 2016-12-16.
Experiment type: XRAY
Resolution: 1.08 Å
R-factor: N/A
AEROSPACI score: 0.75 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Galectin-8
    Species: Homo sapiens [TaxId:9606]
    Gene: LGALS8
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5gzca_
  • Heterogens: GOL, NA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5gzcA (A:)
    nlqniiynpvipfvgtipdqldpgtlivirghvpsdadrfqvdlqngssmkpradvafhf
    nprfkragcivcntlinekwgreeitydtpfkreksfeivimvlkdkfqvavngkhtlly
    ghrigpekidtlgiygkvnihsigfsfssdlq