PDB entry 5gz9

View 5gz9 on RCSB PDB site
Description: crystal structure of catalytic domain of protein o-mannosyl kinase in complexes with amp-pnp, magnesium ions and glycopeptide
Deposited on 2016-09-27, released 2017-03-29
The last revision was dated 2020-07-29, with a file datestamp of 2020-07-02.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: N/A
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Protein O-mannose kinase
    Species: Mus musculus [TaxId:10090]
    Gene: pomk, sgk196
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q3TUA9
      • engineered mutation (21)
      • engineered mutation (119)
  • Heterogens: ANP, MG, MAN, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >5gz9A (A:)
    grstadsrrcppgyfrmgrmrqcsrwlsceelrtevrqlkrvgegavkrvflsewkehkv
    alsrltrlemkedflhglqmlkslqsehvvtlvgyceedgtilteyhplgslsnleetlq
    lskyqdvntwqhrlqlameyvsiinylhhsplgtrvmcdsndlpktlsqylltsnfsiva
    ndldalplvdhdsgvlikcghrelhgdfvapeqlwpygedtpfqddlmpsynekvdiwki
    pdvssfllghvegsdmvrfhlfdihkacksqipaerptaqnvldayqrvfhslrdtvmsq
    tkeml
    

    Sequence, based on observed residues (ATOM records):
    >5gz9A (A:)
    cppgyfrmgrmrqcsrwlsceelrtevrqlkrvgegavkrvflsewkehkvalsrltrle
    mkedflhglqmlkslqsehvvtlvgyceedgtilteyhplgslsnleetlqkyqdvntwq
    hrlqlameyvsiinylhhsplgtrvmcdsndlpktlsqylltsnfsivandldalplvds
    gvlikcghrelhgdfvapeqlwpygedtpfqddlmpsynekvdiwkipdvssfllghveg
    sdmvrfhlfdihkacksqipaerptaqnvldayqrvfhsl