PDB entry 5gz4

View 5gz4 on RCSB PDB site
Description: crystal structure of snake venom phosphodiesterase (pde) from taiwan cobra (naja atra atra)
Deposited on 2016-09-26, released 2017-09-27
The last revision was dated 2020-07-29, with a file datestamp of 2020-07-02.
Experiment type: XRAY
Resolution: 2.55 Å
R-factor: N/A
AEROSPACI score: 0.18 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Snake venom phosphodiesterase (PDE)
    Species: Naja atra [TaxId:8656]
    Database cross-references and differences (RAF-indexed):
    • PDB 5GZ4
  • Heterogens: ZN, CA, EDO, NAG, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >5gz4A (A:)
    lkqskqplescrnrcnetfseelsycscdnkcterkaccwdyqdicvlptqswscnklrc
    gekrmanvlcscsedcltkkdcctdyksickretswlkdqcasssasqcpegfdqsplil
    fsmdgfraeyletwdtlmpninklktcgthakymravyptktfvnhytivtglyaethgi
    idnnmydvklnqnfslsgsnmrnaawwggqpiwhtasyqglkaatyfwpgsevkingsyp
    tiykvynkstpfearvmevlkwldlpkakrpdfstlyieepdttghkfgpvsgqvikslq
    madrtlgmlmeglkqrnlhncvnlilladhgmeaiscnrleymtdyfntvdffmyegaap
    rirsknvpkdfytfdseaivkkltcrkpkqhfkaylakdlpkrlhfanniridkvnlmvd
    rqwlavrnkkykycsggthgydnefksmeaiflahgpgfkektevtsfenievynlmcdl
    lklkpapnngthgslnhllknpfynpspakeqspplyclfgpvpspdvsgckcssitdle
    avnqrlnlidqakmqseadnlpygrphvlqhskycllhqtkyisaysqdilmplwnsyti
    skslvkptsappsasdclrldvriptvqsqtcsnyqpdlaitpgflyppdfsssgpeqyd
    alitsnivpmykefarlwnyfhstllpkyaternglnvisgpifdynydghfdpydtidq
    yvnntkipipthyfvvltscenstktplncppgslkvlsfilphrpdnsescadkspdnl
    wveermqthtarvrdvelltgldfysalkqplsetlrlktflpifinsvn
    

    Sequence, based on observed residues (ATOM records):
    >5gz4A (A:)
    crnrcnetfsycscdnkcterkaccwdyqdicvlptqswscnklrcgekrmanvlcscse
    dcltkkdcctdyksickretswlkdqcassqcpegfdqsplilfsmdgfraeyletwdtl
    mpninklktcgthakymravyptktfvnhytivtglyaethgiidnnmydvklnqnfsls
    gsnmrnaawwggqpiwhtasyqglkaatyfwpgsevkingsyptiykvynkstpfearvm
    evlkwldlpkakrpdfstlyieepdttghkfgpvsgqvikslqmadrtlgmlmeglkqrn
    lhncvnlilladhgmeaiscnrleymtdyfntvdffmyegaaprirsknvpkdfytfdse
    aivkkltcrkpkqhfkaylakdlpkrlhfanniridkvnlmvdrqwlavrnkkykycsgg
    thgydnefksmeaiflahgpgfkektevtsfenievynlmcdllklkpapnngthgslnh
    llknpfynpspakeqspplyclfgpvpspdvsgckcssitdleavnqrlnlidqakmqse
    adnlpygrphvlqhskycllhqtkyisaysqdilmplwnsytiskslpsasdclrldvri
    ptvqsqtcsnyqpdlaitpgflyppdfsssgpeqydalitsnivpmykefarlwnyfhst
    llpkyaternglnvisgpifdynydghfdpydtidqyvnntkipipthyfvvltscenst
    ktplncppgslkvlsfilphrpdnsescadkspdnlwveermqthtarvrdvelltgldf
    ysalkqplsetlrlktflpifins