PDB entry 5gz3

View 5gz3 on RCSB PDB site
Description: structure of d-amino acid dehydrogenase in complex with nadp
Deposited on 2016-09-26, released 2017-04-12
The last revision was dated 2017-12-06, with a file datestamp of 2017-12-01.
Experiment type: XRAY
Resolution: 1.59 Å
R-factor: N/A
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: meso-diaminopimelate d-dehydrogenase
    Species: Ureibacillus thermosphaericus [TaxId:51173]
    Gene: ddh
    Database cross-references and differences (RAF-indexed):
    • Uniprot G1UII1 (Start-325)
      • engineered mutation (93)
      • engineered mutation (153)
      • engineered mutation (157)
      • engineered mutation (172)
      • engineered mutation (198)
      • engineered mutation (223)
      • engineered mutation (248)
  • Chain 'B':
    Compound: meso-diaminopimelate d-dehydrogenase
    Species: Ureibacillus thermosphaericus [TaxId:51173]
    Gene: ddh
    Database cross-references and differences (RAF-indexed):
    • Uniprot G1UII1 (Start-325)
      • engineered mutation (93)
      • engineered mutation (153)
      • engineered mutation (157)
      • engineered mutation (172)
      • engineered mutation (198)
      • engineered mutation (248)
  • Heterogens: NAP, EDO, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >5gz3A (A:)
    mskirigivgygnlgrgveaaiqqnpdmelvavftrrdpktvavksnvkvlhvddaqsyk
    deidvmilcggsatdlpeqgpyfaqyfntidsfatharipdyfdavnaaaeqsgkvaiis
    vgwdpglfslnrllgevvlpvgntytfwgkgvslghsgairriqgvknavqyiipideav
    nrvrsgenpelstrekhamecfvvleegadpakveheiktmpnffdeydttvhfiseeel
    kqnhsgmpnggfvirsgksdeghkqiiefslnlesnpmftssalvayaraayrlsqngdk
    gaktvfdipfgllspkspedlrkell
    

    Sequence, based on observed residues (ATOM records):
    >5gz3A (A:)
    skirigivgygnlgrgveaaiqqnpdmelvavftrrdpktvavksnvkvlhvddaqsykd
    eidvmilcggsatdlpeqgpyfaqyfntidsfatharipdyfdavnaaaeqsgkvaiisv
    gwdpglfslnrllgevvlpvgntytfwgkgvslghsgairriqgvknavqyiipideavn
    rvrsgenpelstrekhamecfvvleegadpakveheiktmpnffdeydttvhfiseeelk
    qnhsgmpnggfvirsgksdeghkqiiefslnlesnpmftssalvayaraayrlsqngdkg
    aktvfdipfgllspkspedlrkell
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >5gz3B (B:)
    mskirigivgygnlgrgveaaiqqnpdmelvavftrrdpktvavksnvkvlhvddaqsyk
    deidvmilcggsatdlpeqgpyfaqyfntidsfatharipdyfdavnaaaeqsgkvaiis
    vgwdpglfslnrllgevvlpvgntytfwgkgvslghsgairriqgvknavqyiipideav
    nrvrsgenpelstrekhamecfvvleegadpakveheiktmpnffdeydttvhfiseeel
    kqnhsgmpnggfvirsgksdeghkqiiefslnlesnpmftssalvayaraayrlsqngdk
    gaktvfdipfgllspkspedlrkell
    

    Sequence, based on observed residues (ATOM records):
    >5gz3B (B:)
    skirigivgygnlgrgveaaiqqnpdmelvavftrrdpktvavksnvkvlhvddaqsykd
    eidvmilcggsatdlpeqgpyfaqyfntidsfatharipdyfdavnaaaeqsgkvaiisv
    gwdpglfslnrllgevvlpvgntytfwgkgvslghsgairriqgvknavqyiipideavn
    rvrsgenpelstrekhamecfvvleegadpakveheikteydttvhfiseeelkqnhsgm
    pnggfvirsgksdeghkqiiefslnlesnpmftssalvayaraayrlsqngdkgaktvfd
    ipfgllspkspedlrkell