PDB entry 5gyn

View 5gyn on RCSB PDB site
Description: Crystal structure of human pyridoxal 5'-phosphate phosphatase (Chronophin) mutant - C221S
Class: hydrolase
Keywords: hydrolase
Deposited on 2016-09-23, released 2017-09-27
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-09-27, with a file datestamp of 2017-09-22.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: pyridoxal phosphate phosphatase
    Species: Homo sapiens [TaxId:9606]
    Gene: PDXP, CIN, PLP, PLPP
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q96GD0 (5-End)
      • engineered mutation (225)
    Domains in SCOPe 2.07: d5gyna_
  • Heterogens: MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5gynA (A:)
    gamdpmarcerlrgaalrdvlgraqgvlfdcdgvlwngeravpgapellerlaragkaal
    fvsnnsrrarpelalrfarlgfgglraeqlfssalcaarllrqrlpgppdapgavfvlgg
    eglraelraaglrlagdpsagdgaaprvravlvgydehfsfaklreacahlrdpecllva
    tdrdpwhplsdgsrtpgtgslaaavetasgrqalvvgkpspymfesitenfsidpartlm
    vgdrletdilfghrcgmttvltltgvsrleeaqaylaagqhdlvphyyvesiadltegle
    d
    

    Sequence, based on observed residues (ATOM records): (download)
    >5gynA (A:)
    marcerlrgaalrdvlgraqgvlfdcdgvlwngeravpgapellerlaragkaalfvsnn
    srrarpelalrfarlgfgglraeqlfssalcaarllrqrlpgppdapgavfvlggeglra
    elraaglrlagdpsagdgaaprvravlvgydehfsfaklreacahlrdpecllvatdrdp
    whplsdgsrtpgtgslaaavetasgrqalvvgkpspymfesitenfsidpartlmvgdrl
    etdilfghrcgmttvltltgvsrleeaqaylaagqhdlvphyyvesiadltegle