PDB entry 5gym

View 5gym on RCSB PDB site
Description: crystal structure of rxr-lbd complexed with fluorescent ligand at 2.60 angstroms resolution
Deposited on 2016-09-23, released 2017-11-01
Made obsolete by 6jno on 2019-11-20

The last revision was dated 2019-11-20, with a file datestamp of 2019-11-15.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: N/A
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Retinoic acid receptor RXR-alpha
    Species: Homo sapiens [TaxId:9606]
    Gene: RXRA, NR2B1
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: Retinoic acid receptor RXR-alpha
    Species: Homo sapiens [TaxId:9606]
    Gene: RXRA, NR2B1
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: Retinoic acid receptor RXR-alpha
    Species: Homo sapiens [TaxId:9606]
    Gene: RXRA, NR2B1
    Database cross-references and differences (RAF-indexed):
  • Chain 'D':
    Compound: Retinoic acid receptor RXR-alpha
    Species: Homo sapiens [TaxId:9606]
    Gene: RXRA, NR2B1
    Database cross-references and differences (RAF-indexed):
  • Chain 'E':
    Compound: Retinoic acid receptor RXR-alpha
    Species: Homo sapiens [TaxId:9606]
    Gene: RXRA, NR2B1
    Database cross-references and differences (RAF-indexed):
  • Chain 'F':
    Compound: Retinoic acid receptor RXR-alpha
    Species: Homo sapiens [TaxId:9606]
    Gene: RXRA, NR2B1
    Database cross-references and differences (RAF-indexed):
  • Chain 'G':
    Compound: Retinoic acid receptor RXR-alpha
    Species: Homo sapiens [TaxId:9606]
    Gene: RXRA, NR2B1
    Database cross-references and differences (RAF-indexed):
  • Chain 'H':
    Compound: Retinoic acid receptor RXR-alpha
    Species: Homo sapiens [TaxId:9606]
    Gene: RXRA, NR2B1
    Database cross-references and differences (RAF-indexed):
  • Heterogens: WY5

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >5gymA (A:)
    mgsshhhhhhssglvprgshmnedmpverileaelavepktetyveanmglnpsspndpv
    tnicqaadkqlftlvewakriphfselplddqvillragwnelliasfshrsiavkdgil
    latglhvhrnsahsagvgaifdrvltelvskmrdmqmdktelgclraivlfnpdskglsn
    paevealrekvyasleayckhkypeqpgrfaklllrlpalrsiglkclehlfffkligdt
    pidtflmemleaphqmt
    

    Sequence, based on observed residues (ATOM records):
    >5gymA (A:)
    pvtnicqaadkqlftlvewakriphfselplddqvillragwnelliasfshrsiavkdg
    illalhvhrnsahsagvgaifdrvltelvskmrdmqmdktelgclraivlfnpdskglsn
    paevealrekvyasleayckhkypeqpgrfaklllrlpalrsiglkclehlfffkligdt
    pidtflmemleap
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >5gymB (B:)
    mgsshhhhhhssglvprgshmnedmpverileaelavepktetyveanmglnpsspndpv
    tnicqaadkqlftlvewakriphfselplddqvillragwnelliasfshrsiavkdgil
    latglhvhrnsahsagvgaifdrvltelvskmrdmqmdktelgclraivlfnpdskglsn
    paevealrekvyasleayckhkypeqpgrfaklllrlpalrsiglkclehlfffkligdt
    pidtflmemleaphqmt
    

    Sequence, based on observed residues (ATOM records):
    >5gymB (B:)
    dpvtnicqaadkqlftlvewakriphfselplddqvillragwnelliasfshrsiavkd
    gillatglhvhrnsahsagvgaifdrvltelvskmrdmqmdktelgclraivlfnpdskg
    lsnpaevealrekvyasleayckhkypeqpgrfaklllrlpalrsiglkclehlfffkli
    gdtpidtflmemleap
    

  • Chain 'C':
    Sequence, based on SEQRES records:
    >5gymC (C:)
    mgsshhhhhhssglvprgshmnedmpverileaelavepktetyveanmglnpsspndpv
    tnicqaadkqlftlvewakriphfselplddqvillragwnelliasfshrsiavkdgil
    latglhvhrnsahsagvgaifdrvltelvskmrdmqmdktelgclraivlfnpdskglsn
    paevealrekvyasleayckhkypeqpgrfaklllrlpalrsiglkclehlfffkligdt
    pidtflmemleaphqmt
    

    Sequence, based on observed residues (ATOM records):
    >5gymC (C:)
    dpvtnicqaadkqlftlvewakriphfselplddqvillragwnelliasfshrsiavkd
    gillatglhvhrnsahsagvgaifdrvltelvskmrdmqmdktelgclraivlfnpdskg
    lsnpaevealrekvyasleayckhkypeqpgrfaklllrlpalrsiglkclkligdtpid
    tflmemleap
    

  • Chain 'D':
    Sequence, based on SEQRES records:
    >5gymD (D:)
    mgsshhhhhhssglvprgshmnedmpverileaelavepktetyveanmglnpsspndpv
    tnicqaadkqlftlvewakriphfselplddqvillragwnelliasfshrsiavkdgil
    latglhvhrnsahsagvgaifdrvltelvskmrdmqmdktelgclraivlfnpdskglsn
    paevealrekvyasleayckhkypeqpgrfaklllrlpalrsiglkclehlfffkligdt
    pidtflmemleaphqmt
    

    Sequence, based on observed residues (ATOM records):
    >5gymD (D:)
    pvtnicqaadkqlftlvewakriphfselplddqvillragwnelliasfshrsiavkdg
    illlhvhrnsahsagvgaifdrvltelvskmrdmqmdktelgclraivlfnpdskglsnp
    aevealrekvyasleayckhkypeqpgrfaklllrlpalrsiglkclehlfffkligdtp
    idtflmemleap
    

  • Chain 'E':
    Sequence, based on SEQRES records:
    >5gymE (E:)
    mgsshhhhhhssglvprgshmnedmpverileaelavepktetyveanmglnpsspndpv
    tnicqaadkqlftlvewakriphfselplddqvillragwnelliasfshrsiavkdgil
    latglhvhrnsahsagvgaifdrvltelvskmrdmqmdktelgclraivlfnpdskglsn
    paevealrekvyasleayckhkypeqpgrfaklllrlpalrsiglkclehlfffkligdt
    pidtflmemleaphqmt
    

    Sequence, based on observed residues (ATOM records):
    >5gymE (E:)
    vtnicqaadkqlftlvewakriphfselplddqvillragwnelliasfshrsiavkdgi
    llathvhrnsahsagvgaifdrvltelvskmrdmqmdktelgclraivlfnpdskglsnp
    aevealrekvyasleayckhkypeqpgrfaklllrlpalrsiglkclehlfffkligdtp
    idtflmemlea
    

  • Chain 'F':
    Sequence, based on SEQRES records:
    >5gymF (F:)
    mgsshhhhhhssglvprgshmnedmpverileaelavepktetyveanmglnpsspndpv
    tnicqaadkqlftlvewakriphfselplddqvillragwnelliasfshrsiavkdgil
    latglhvhrnsahsagvgaifdrvltelvskmrdmqmdktelgclraivlfnpdskglsn
    paevealrekvyasleayckhkypeqpgrfaklllrlpalrsiglkclehlfffkligdt
    pidtflmemleaphqmt
    

    Sequence, based on observed residues (ATOM records):
    >5gymF (F:)
    ndpvtnicqaadkqlftlvewakriphfselplddqvillragwnelliasfshrsiavk
    dgillglhvhrnsahsagvgaifdrvltelvskmrdmqmdktelgclraivlfnpdskgl
    snpaevealrekvyasleayckhkypeqpgrfaklllrlpalrsiglkclehlfffklig
    dtpidtflmemleap
    

  • Chain 'G':
    Sequence, based on SEQRES records:
    >5gymG (G:)
    mgsshhhhhhssglvprgshmnedmpverileaelavepktetyveanmglnpsspndpv
    tnicqaadkqlftlvewakriphfselplddqvillragwnelliasfshrsiavkdgil
    latglhvhrnsahsagvgaifdrvltelvskmrdmqmdktelgclraivlfnpdskglsn
    paevealrekvyasleayckhkypeqpgrfaklllrlpalrsiglkclehlfffkligdt
    pidtflmemleaphqmt
    

    Sequence, based on observed residues (ATOM records):
    >5gymG (G:)
    ndpvtnicqaadkqlftlvewakriphfselplddqvillragwnelliasfshrsiavk
    dgilllhvhrnsahsagvgaifdrvltelvskmrdmqmdktelgclraivlfnpdskgls
    npaevealrekvyasleayckhkypeqpgrfaklllrlpalrsiglkclehlfffkligd
    tpidtflmemle
    

  • Chain 'H':
    Sequence, based on SEQRES records:
    >5gymH (H:)
    mgsshhhhhhssglvprgshmnedmpverileaelavepktetyveanmglnpsspndpv
    tnicqaadkqlftlvewakriphfselplddqvillragwnelliasfshrsiavkdgil
    latglhvhrnsahsagvgaifdrvltelvskmrdmqmdktelgclraivlfnpdskglsn
    paevealrekvyasleayckhkypeqpgrfaklllrlpalrsiglkclehlfffkligdt
    pidtflmemleaphqmt
    

    Sequence, based on observed residues (ATOM records):
    >5gymH (H:)
    pndpvtnicqaadkqlftlvewakriphfselplddqvillragwnelliasfshrsiav
    kdgillhvhrnsahsagvgaifdrvltelvskmrdmqmdktelgclraivlfnpdskgls
    npaevealrekvyasleayckhkypeqpgrfaklllrlpalrsiglkclehlfffkligd
    tpidtflmemle