PDB entry 5gyk

View 5gyk on RCSB PDB site
Description: crystal structure of mdm12-deletion mutant
Deposited on 2016-09-22, released 2016-11-16
The last revision was dated 2016-12-14, with a file datestamp of 2016-12-09.
Experiment type: XRAY
Resolution: 3.6 Å
R-factor: N/A
AEROSPACI score: 0.07 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Mitochondrial distribution and morphology protein 12
    Species: Saccharomyces cerevisiae S288c [TaxId:559292]
    Gene: MDM12, YOL009C
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q92328 (1-73)
      • expression tag (0)
    • Uniprot Q92328 (79-End)
  • Chain 'B':
    Compound: Mitochondrial distribution and morphology protein 12
    Species: Saccharomyces cerevisiae S288c [TaxId:559292]
    Gene: MDM12, YOL009C
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q92328 (1-End)
      • expression tag (0)
    • Uniprot Q92328 (79-End)
  • Chain 'C':
    Compound: Mitochondrial distribution and morphology protein 12
    Species: Saccharomyces cerevisiae S288c [TaxId:559292]
    Gene: MDM12, YOL009C
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q92328 (1-End)
      • expression tag (0)
    • Uniprot Q92328 (79-End)
  • Chain 'D':
    Compound: Mitochondrial distribution and morphology protein 12
    Species: Saccharomyces cerevisiae S288c [TaxId:559292]
    Gene: MDM12, YOL009C
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q92328 (1-73)
      • expression tag (0)
    • Uniprot Q92328 (79-End)
  • Chain 'E':
    Compound: Mitochondrial distribution and morphology protein 12
    Species: Saccharomyces cerevisiae S288c [TaxId:559292]
    Gene: MDM12, YOL009C
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q92328 (1-73)
      • expression tag (0)
    • Uniprot Q92328 (79-End)
  • Chain 'F':
    Compound: Mitochondrial distribution and morphology protein 12
    Species: Saccharomyces cerevisiae S288c [TaxId:559292]
    Gene: MDM12, YOL009C
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q92328 (1-73)
      • expression tag (0)
    • Uniprot Q92328 (79-End)
  • Heterogens: PEE

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >5gykA (A:)
    gmsfdinwstlesdnrlndlirkhlnsylqntqlpsyvsnlrvldfdlgkvgpaitlkei
    tdpldefydsireeggsggspndiqflleveykgdllvtigadlvlnypvekfmtlpvkl
    sisdiglhslcivaclskqlflsflcdvsdpalddnqtvldpkgpilaatkplerisivr
    smkieteigeqyqgqgsvlrsvgeleqflftifkdflrkelawpswinldfndgde
    

    Sequence, based on observed residues (ATOM records):
    >5gykA (A:)
    gmsfdinwstlesdnrlndlirkhlnsylqntqlpsyvsnlrvldfdlgkvgpaitlkei
    tdpldefydsireespndiqflleveykgdllvtigadlvlnypvekfmtlpvklsisdi
    glhslcivaclskqlflsflcdvsdpalddnqtvldpkgpilaatkplerisivrsmkie
    teigeqyqgqgsvlrsvgeleqflftifkdflrkelawpswinldfn
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >5gykB (B:)
    gmsfdinwstlesdnrlndlirkhlnsylqntqlpsyvsnlrvldfdlgkvgpaitlkei
    tdpldefydsireeggsggspndiqflleveykgdllvtigadlvlnypvekfmtlpvkl
    sisdiglhslcivaclskqlflsflcdvsdpalddnqtvldpkgpilaatkplerisivr
    smkieteigeqyqgqgsvlrsvgeleqflftifkdflrkelawpswinldfndgde
    

    Sequence, based on observed residues (ATOM records):
    >5gykB (B:)
    gmsfdinwstlesdnrlndlirkhlnsylqntqlpsyvsnlrvldfdlgkvgpaitlkei
    tdpldefydsirespndiqflleveykgdllvtigadlvlnypvekfmtlpvklsisdig
    lhslcivaclskqlflsflcdvsdpalddnqtvldpkgpilaatkplerisivrsmkiet
    eigeqyqgqgsvlrsvgeleqflftifkdflrkelawpswinl
    

  • Chain 'C':
    Sequence, based on SEQRES records:
    >5gykC (C:)
    gmsfdinwstlesdnrlndlirkhlnsylqntqlpsyvsnlrvldfdlgkvgpaitlkei
    tdpldefydsireeggsggspndiqflleveykgdllvtigadlvlnypvekfmtlpvkl
    sisdiglhslcivaclskqlflsflcdvsdpalddnqtvldpkgpilaatkplerisivr
    smkieteigeqyqgqgsvlrsvgeleqflftifkdflrkelawpswinldfndgde
    

    Sequence, based on observed residues (ATOM records):
    >5gykC (C:)
    gmsfdinwstlesdnrlndlirkhlnsylqntqlpsyvsnlrvldfdlgkvgpaitlkei
    tdpldefydsirespndiqflleveykgdllvtigadlvlnypvekfmtlpvklsisdig
    lhslcivaclskqlflsflcdvsdpalddnqtvldpkgpilaatkplerisivrsmkiet
    eigeqyqgqgsvlrsvgeleqflftifkdflrkelawpswinldfn
    

  • Chain 'D':
    Sequence, based on SEQRES records:
    >5gykD (D:)
    gmsfdinwstlesdnrlndlirkhlnsylqntqlpsyvsnlrvldfdlgkvgpaitlkei
    tdpldefydsireeggsggspndiqflleveykgdllvtigadlvlnypvekfmtlpvkl
    sisdiglhslcivaclskqlflsflcdvsdpalddnqtvldpkgpilaatkplerisivr
    smkieteigeqyqgqgsvlrsvgeleqflftifkdflrkelawpswinldfndgde
    

    Sequence, based on observed residues (ATOM records):
    >5gykD (D:)
    gmsfdinwstlesdnrlndlirkhlnsylqntqlpsyvsnlrvldfdlgkvgpaitlkei
    tdpldefydsireespndiqflleveykgdllvtigadlvlnypvekfmtlpvklsisdi
    glhslcivaclskqlflsflcdvsdpalddnqtvldpkgpilaatkplerisivrsmkie
    teigeqyqgqgsvlrsvgeleqflftifkdflrkelawpswinldfn
    

  • Chain 'E':
    Sequence, based on SEQRES records:
    >5gykE (E:)
    gmsfdinwstlesdnrlndlirkhlnsylqntqlpsyvsnlrvldfdlgkvgpaitlkei
    tdpldefydsireeggsggspndiqflleveykgdllvtigadlvlnypvekfmtlpvkl
    sisdiglhslcivaclskqlflsflcdvsdpalddnqtvldpkgpilaatkplerisivr
    smkieteigeqyqgqgsvlrsvgeleqflftifkdflrkelawpswinldfndgde
    

    Sequence, based on observed residues (ATOM records):
    >5gykE (E:)
    gmsfdinwstlesdnrlndlirkhlnsylqntqlpsyvsnlrvldfdlgkvgpaitlkei
    tdpldefydsireespndiqflleveykgdllvtigadlvlnypvekfmtlpvklsisdi
    glhslcivaclskqlflsflcdvsdpalddnqtvldpkgpilaatkplerisivrsmkie
    teigeqyqgqgsvlrsvgeleqflftifkdflrkelawpswinldf
    

  • Chain 'F':
    Sequence, based on SEQRES records:
    >5gykF (F:)
    gmsfdinwstlesdnrlndlirkhlnsylqntqlpsyvsnlrvldfdlgkvgpaitlkei
    tdpldefydsireeggsggspndiqflleveykgdllvtigadlvlnypvekfmtlpvkl
    sisdiglhslcivaclskqlflsflcdvsdpalddnqtvldpkgpilaatkplerisivr
    smkieteigeqyqgqgsvlrsvgeleqflftifkdflrkelawpswinldfndgde
    

    Sequence, based on observed residues (ATOM records):
    >5gykF (F:)
    gmsfdinwstlesdnrlndlirkhlnsylqntqlpsyvsnlrvldfdlgkvgpaitlkei
    tdpldefydsireespndiqflleveykgdllvtigadlvlnypvekfmtlpvklsisdi
    glhslcivaclskqlflsflcdvsdpalddnqtvldpkgpilaatkplerisivrsmkie
    teigeqyqgqgsvlrsvgeleqflftifkdflrkelawpswinld