PDB entry 5gyg

View 5gyg on RCSB PDB site
Description: crystal structure of enzbleach xylanase t28c+t60c mutant with three n- teminal residue truncation
Deposited on 2016-09-22, released 2017-09-27
The last revision was dated 2019-04-10, with a file datestamp of 2019-04-05.
Experiment type: XRAY
Resolution: 1.74 Å
R-factor: N/A
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: endo-1,4-beta-xylanase
    Species: termite gut metagenome [TaxId:433724]
    Database cross-references and differences (RAF-indexed):
    • PDB 5GYG (0-277)
  • Chain 'B':
    Compound: endo-1,4-beta-xylanase
    Species: termite gut metagenome [TaxId:433724]
    Database cross-references and differences (RAF-indexed):
    • PDB 5GYG (0-277)
  • Heterogens: HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >5gygA (A:)
    qvvkptderiidpstantqltggvcynttsggnkplagspygyetwidtgggvcslcwyg
    adqgggaafkatwtnphdflgrlgyfwnenkpyshyeniycgfnytrsgrktagdysyig
    iygwsrnpsasnsnerlieyyivedwfgnqwqadtspmginttggtvmgsftvdgssyqi
    ikntrvnqpsiegdktfvqyfsirqsprksgtisitehfkkweklgmklgdnmyeckfli
    eagagegffdarliqfyradnegnilqitplehhhhhh
    

    Sequence, based on observed residues (ATOM records):
    >5gygA (A:)
    qvvkptderiidpstantqltggvcynttsggnkplagspygyetwidtgggvcslcwyg
    adqgggaafkatwtnphdflgrlgyfwnenkpyshyeniycgfnytrsgrktagdysyig
    iygwsrnpsasnsnerlieyyivedwfgnqwqadtspmginttggtvmgsftvdgssyqi
    ikntrvnqpsiegdktfvqyfsirqsprksgtisitehfkkweklgmklgdnmyeckfli
    eagagegffdarliqfyradnegnilqitphh
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >5gygB (B:)
    qvvkptderiidpstantqltggvcynttsggnkplagspygyetwidtgggvcslcwyg
    adqgggaafkatwtnphdflgrlgyfwnenkpyshyeniycgfnytrsgrktagdysyig
    iygwsrnpsasnsnerlieyyivedwfgnqwqadtspmginttggtvmgsftvdgssyqi
    ikntrvnqpsiegdktfvqyfsirqsprksgtisitehfkkweklgmklgdnmyeckfli
    eagagegffdarliqfyradnegnilqitplehhhhhh
    

    Sequence, based on observed residues (ATOM records):
    >5gygB (B:)
    qvvkptderiidpstantqltggvcynttsggnkplagspygyetwidtgggvcslcwyg
    adqgggaafkatwtnphdflgrlgyfwnenkpyshyeniycgfnytrsgrktagdysyig
    iygwsrnpsasnsnerlieyyivedwfgnqwqadtspmginttggtvmgsftvdgssyqi
    ikntrvnqpsiegdktfvqyfsirqsprksgtisitehfkkweklgmklgdnmyeckfli
    eagagegffdarliqfyradnegnilqitphh