PDB entry 5gyc

View 5gyc on RCSB PDB site
Description: crystal structure of enzbleach xylanase k73r+k185r and t28c+t60c mutant
Deposited on 2016-09-22, released 2017-08-30
The last revision was dated 2017-09-20, with a file datestamp of 2017-09-15.
Experiment type: XRAY
Resolution: 1.4 Å
R-factor: N/A
AEROSPACI score: 0.52 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: endo-1,4-beta-xylanase
    Species: termite gut metagenome [TaxId:433724]
    Database cross-references and differences (RAF-indexed):
    • PDB 5GYC (Start-280)
  • Heterogens: HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >5gycA (A:)
    mgeqvvkptderiidpstantqltggvcynttsggnkplagspygyetwidtgggvcslc
    wygadqgggaafratwtnphdflgrlgyfwnenkpyshyeniycgfnytrsgrktagdys
    yigiygwsrnpsasnsnerlieyyivedwfgnqwqadtspmginttggtvmgsftvdgss
    yqiirntrvnqpsiegdktfvqyfsirqsprksgtisitehfkkweklgmklgdnmyeck
    flieagagegffdarliqfyradnegnilqitplehhhhhh
    

    Sequence, based on observed residues (ATOM records):
    >5gycA (A:)
    qvvkptderiidpstantqltggvcynttsggnkplagspygyetwidtgggvcslcwyg
    adqgggaafratwtnphdflgrlgyfwnenkpyshyeniycgfnytrsgrktagdysyig
    iygwsrnpsasnsnerlieyyivedwfgnqwqadtspmginttggtvmgsftvdgssyqi
    irntrvnqpsiegdktfvqyfsirqsprksgtisitehfkkweklgmklgdnmyeckfli
    eagagegffdarliqfyradnegnilqitphh