PDB entry 5gy7

View 5gy7 on RCSB PDB site
Description: X-Ray structure of H243I mutant of UDP-Galactose 4-epimerase from E.coli:evidence for existence of open and closed active site during catalysis.
Class: isomerase
Keywords: Induced fit mechanism, ISOMERASE
Deposited on 2016-09-21, released 2016-11-30
The last revision prior to the SCOPe 2.07 freeze date was dated 2016-11-30, with a file datestamp of 2016-11-25.
Experiment type: XRAY
Resolution: 1.43 Å
R-factor: N/A
AEROSPACI score: 0.52 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: UDP-glucose 4-epimerase
    Species: Escherichia coli (strain K12) [TaxId:83333]
    Gene: galE, galD, b0759, JW0742
    Database cross-references and differences (RAF-indexed):
    • Uniprot P09147 (0-337)
      • engineered mutation (242)
    Domains in SCOPe 2.07: d5gy7a_
  • Chain 'B':
    Compound: UDP-glucose 4-epimerase
    Species: Escherichia coli (strain K12) [TaxId:83333]
    Gene: galE, galD, b0759, JW0742
    Database cross-references and differences (RAF-indexed):
    • Uniprot P09147 (0-337)
      • engineered mutation (242)
    Domains in SCOPe 2.07: d5gy7b_
  • Heterogens: UDP, NAD, GOL, NO3, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5gy7A (A:)
    mrvlvtggsgyigshtcvqllqnghdviildnlcnskrsvlpvierlggkhptfvegdir
    nealmteilhdhaidtvihfaglkavgesvqkpleyydnnvngtlrlisamraanvknfi
    fsssatvygdqpkipyvesfptgtpqspygksklmveqiltdlqkaqpdwsiallryfnp
    vgahpsgdmgedpqgipnnlmpyiaqvavgrrdslaifgndyptedgtgvrdyihvmdla
    dgivvameklankpgvhiynlgagvgnsvldvvnafskacgkpvnyhfaprregdlpayw
    adaskadrelnwrvtrtldemaqdtwhwqsrhpqgypdhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5gy7A (A:)
    mrvlvtggsgyigshtcvqllqnghdviildnlcnskrsvlpvierlggkhptfvegdir
    nealmteilhdhaidtvihfaglkavgesvqkpleyydnnvngtlrlisamraanvknfi
    fsssatvygdqpkipyvesfptgtpqspygksklmveqiltdlqkaqpdwsiallryfnp
    vgahpsgdmgedpqgipnnlmpyiaqvavgrrdslaifgndyptedgtgvrdyihvmdla
    dgivvameklankpgvhiynlgagvgnsvldvvnafskacgkpvnyhfaprregdlpayw
    adaskadrelnwrvtrtldemaqdtwhwqsrhpqgypd
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5gy7B (B:)
    mrvlvtggsgyigshtcvqllqnghdviildnlcnskrsvlpvierlggkhptfvegdir
    nealmteilhdhaidtvihfaglkavgesvqkpleyydnnvngtlrlisamraanvknfi
    fsssatvygdqpkipyvesfptgtpqspygksklmveqiltdlqkaqpdwsiallryfnp
    vgahpsgdmgedpqgipnnlmpyiaqvavgrrdslaifgndyptedgtgvrdyihvmdla
    dgivvameklankpgvhiynlgagvgnsvldvvnafskacgkpvnyhfaprregdlpayw
    adaskadrelnwrvtrtldemaqdtwhwqsrhpqgypdhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5gy7B (B:)
    mrvlvtggsgyigshtcvqllqnghdviildnlcnskrsvlpvierlggkhptfvegdir
    nealmteilhdhaidtvihfaglkavgesvqkpleyydnnvngtlrlisamraanvknfi
    fsssatvygdqpkipyvesfptgtpqspygksklmveqiltdlqkaqpdwsiallryfnp
    vgahpsgdmgedpqgipnnlmpyiaqvavgrrdslaifgndyptedgtgvrdyihvmdla
    dgivvameklankpgvhiynlgagvgnsvldvvnafskacgkpvnyhfaprregdlpayw
    adaskadrelnwrvtrtldemaqdtwhwqsrhpqgypd