PDB entry 5gy0

View 5gy0 on RCSB PDB site
Description: Crystal structure of endoglucanase CelQ from Clostridium thermocellum complexed with cellotetraose
Class: hydrolase
Keywords: cellulases, glycosyl hydrolase, hydrolase, cellulosome
Deposited on 2016-09-21, released 2017-09-27
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-09-27, with a file datestamp of 2017-09-22.
Experiment type: XRAY
Resolution: 1.74 Å
R-factor: N/A
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: glucanase
    Species: Clostridium thermocellum [TaxId:1515]
    Gene: celQ
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9AJF8 (Start-601)
      • engineered mutation (224)
      • engineered mutation (408)
    Domains in SCOPe 2.07: d5gy0a1, d5gy0a2
  • Chain 'B':
    Compound: glucanase
    Species: Clostridium thermocellum [TaxId:1515]
    Gene: celQ
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9AJF8 (Start-601)
      • engineered mutation (224)
      • engineered mutation (408)
    Domains in SCOPe 2.07: d5gy0b1, d5gy0b2
  • Heterogens: CA, CL, BGC, BR, PG4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5gy0A (A:)
    magsynyaealqkaiyfyecqqagplpewnrvewrgdatmndevlggwydagdhvkfnlp
    maysaamlgwalyeygddieasgqrlhlernlafaldylvacdrgdsvvyqigdgaadhk
    wwgsaeviekemtrpyfvgkgsavvgqmaaalavgsivlkndtylryakkyfeladatrs
    dstytaangfysshsgfwdellwastwlylatgdrnyldkaesytpklnrqnqttdieyq
    wahcwddchygamillaratgkeeyhkfaqmhldwwtpqgyngkrvaytpgglahldtwg
    plryatteaflafvyadsindpalkqkyynfaksqidyalgsnpdnrsyvvgfgnnppqr
    phhrtahgtwldkrdipekhrhvlygalvggpgrddsyedniedyvknavacdynagfvg
    alcrltaeyggtplanfpppeqrddeffveaainqasdhfteikallnnrsswparlikd
    lsynyymdltevfeagysvddikvtigycesgmdveispithlydniyyikisyidgtni
    cpigqeqyaaelqfriaapqgtkfwdptndfsyqgltrelaktkympvfdgatkifgevp
    gglehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5gy0A (A:)
    synyaealqkaiyfyecqqagplpewnrvewrgdatmndevlggwydagdhvkfnlpmay
    saamlgwalyeygddieasgqrlhlernlafaldylvacdrgdsvvyqigdgaadhkwwg
    saeviekemtrpyfvgkgsavvgqmaaalavgsivlkndtylryakkyfeladatrsdst
    ytaangfysshsgfwdellwastwlylatgdrnyldkaesytpklnrqnqttdieyqwah
    cwddchygamillaratgkeeyhkfaqmhldwwtpqgyngkrvaytpgglahldtwgplr
    yatteaflafvyadsindpalkqkyynfaksqidyalgsnpdnrsyvvgfgnnppqrphh
    rtahgtwldkrdipekhrhvlygalvggpgrddsyedniedyvknavacdynagfvgalc
    rltaeyggtplanfpppeqrddeffveaainqasdhfteikallnnrsswparlikdlsy
    nyymdltevfeagysvddikvtigycesgmdveispithlydniyyikisyidgtnicpi
    gqeqyaaelqfriaapqgtkfwdptndfsyqgltrelaktkympvfdgatkifgevpgg
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5gy0B (B:)
    magsynyaealqkaiyfyecqqagplpewnrvewrgdatmndevlggwydagdhvkfnlp
    maysaamlgwalyeygddieasgqrlhlernlafaldylvacdrgdsvvyqigdgaadhk
    wwgsaeviekemtrpyfvgkgsavvgqmaaalavgsivlkndtylryakkyfeladatrs
    dstytaangfysshsgfwdellwastwlylatgdrnyldkaesytpklnrqnqttdieyq
    wahcwddchygamillaratgkeeyhkfaqmhldwwtpqgyngkrvaytpgglahldtwg
    plryatteaflafvyadsindpalkqkyynfaksqidyalgsnpdnrsyvvgfgnnppqr
    phhrtahgtwldkrdipekhrhvlygalvggpgrddsyedniedyvknavacdynagfvg
    alcrltaeyggtplanfpppeqrddeffveaainqasdhfteikallnnrsswparlikd
    lsynyymdltevfeagysvddikvtigycesgmdveispithlydniyyikisyidgtni
    cpigqeqyaaelqfriaapqgtkfwdptndfsyqgltrelaktkympvfdgatkifgevp
    gglehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5gy0B (B:)
    synyaealqkaiyfyecqqagplpewnrvewrgdatmndevlggwydagdhvkfnlpmay
    saamlgwalyeygddieasgqrlhlernlafaldylvacdrgdsvvyqigdgaadhkwwg
    saeviekemtrpyfvgkgsavvgqmaaalavgsivlkndtylryakkyfeladatrsdst
    ytaangfysshsgfwdellwastwlylatgdrnyldkaesytpklnrqnqttdieyqwah
    cwddchygamillaratgkeeyhkfaqmhldwwtpqgyngkrvaytpgglahldtwgplr
    yatteaflafvyadsindpalkqkyynfaksqidyalgsnpdnrsyvvgfgnnppqrphh
    rtahgtwldkrdipekhrhvlygalvggpgrddsyedniedyvknavacdynagfvgalc
    rltaeyggtplanfpppeqrddeffveaainqasdhfteikallnnrsswparlikdlsy
    nyymdltevfeagysvddikvtigycesgmdveispithlydniyyikisyidgtnicpi
    gqeqyaaelqfriaapqgtkfwdptndfsyqgltrelaktkympvfdgatkifgevpgg