PDB entry 5gxx

View 5gxx on RCSB PDB site
Description: Crystal structure of endoglucanase CelQ from Clostridium thermocellum complexed with Tris
Class: hydrolase
Keywords: cellulases, glycosyl hydrolase, hydrolase, cellulosome
Deposited on 2016-09-21, released 2017-09-27
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-04-10, with a file datestamp of 2019-04-05.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: N/A
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: glucanase
    Species: Clostridium thermocellum [TaxId:1515]
    Gene: celQ
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9AJF8 (Start-601)
      • engineered mutation (224)
      • expression tag (602)
    Domains in SCOPe 2.08: d5gxxa1, d5gxxa2, d5gxxa3
  • Chain 'B':
    Compound: glucanase
    Species: Clostridium thermocellum [TaxId:1515]
    Gene: celQ
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9AJF8 (Start-601)
      • engineered mutation (224)
    Domains in SCOPe 2.08: d5gxxb1, d5gxxb2
  • Heterogens: CA, CL, TRS, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5gxxA (A:)
    magsynyaealqkaiyfyecqqagplpewnrvewrgdatmndevlggwydagdhvkfnlp
    maysaamlgwalyeygddieasgqrlhlernlafaldylvacdrgdsvvyqigdgaadhk
    wwgsaeviekemtrpyfvgkgsavvgqmaaalavgsivlkndtylryakkyfeladatrs
    dstytaangfysshsgfwdellwastwlylatgdrnyldkaesytpklnrqnqttdieyq
    wahcwddchygamillaratgkeeyhkfaqmhldwwtpqgyngkrvaytpgglahldtwg
    plryatteaflafvyadsindpalkqkyynfaksqidyalgsnpdnrsyvvgfgnnppqr
    phhrtahgtwldkrdipekhrhvlygalvggpgrddsyedniedyvknevacdynagfvg
    alcrltaeyggtplanfpppeqrddeffveaainqasdhfteikallnnrsswparlikd
    lsynyymdltevfeagysvddikvtigycesgmdveispithlydniyyikisyidgtni
    cpigqeqyaaelqfriaapqgtkfwdptndfsyqgltrelaktkympvfdgatkifgevp
    gglehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5gxxA (A:)
    synyaealqkaiyfyecqqagplpewnrvewrgdatmndevlggwydagdhvkfnlpmay
    saamlgwalyeygddieasgqrlhlernlafaldylvacdrgdsvvyqigdgaadhkwwg
    saeviekemtrpyfvgkgsavvgqmaaalavgsivlkndtylryakkyfeladatrsdst
    ytaangfysshsgfwdellwastwlylatgdrnyldkaesytpklnrqnqttdieyqwah
    cwddchygamillaratgkeeyhkfaqmhldwwtpqgyngkrvaytpgglahldtwgplr
    yatteaflafvyadsindpalkqkyynfaksqidyalgsnpdnrsyvvgfgnnppqrphh
    rtahgtwldkrdipekhrhvlygalvggpgrddsyedniedyvknevacdynagfvgalc
    rltaeyggtplanfpppeqrddeffveaainqasdhfteikallnnrsswparlikdlsy
    nyymdltevfeagysvddikvtigycesgmdveispithlydniyyikisyidgtnicpi
    gqeqyaaelqfriaapqgtkfwdptndfsyqgltrelaktkympvfdgatkifgevpggl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5gxxB (B:)
    magsynyaealqkaiyfyecqqagplpewnrvewrgdatmndevlggwydagdhvkfnlp
    maysaamlgwalyeygddieasgqrlhlernlafaldylvacdrgdsvvyqigdgaadhk
    wwgsaeviekemtrpyfvgkgsavvgqmaaalavgsivlkndtylryakkyfeladatrs
    dstytaangfysshsgfwdellwastwlylatgdrnyldkaesytpklnrqnqttdieyq
    wahcwddchygamillaratgkeeyhkfaqmhldwwtpqgyngkrvaytpgglahldtwg
    plryatteaflafvyadsindpalkqkyynfaksqidyalgsnpdnrsyvvgfgnnppqr
    phhrtahgtwldkrdipekhrhvlygalvggpgrddsyedniedyvknevacdynagfvg
    alcrltaeyggtplanfpppeqrddeffveaainqasdhfteikallnnrsswparlikd
    lsynyymdltevfeagysvddikvtigycesgmdveispithlydniyyikisyidgtni
    cpigqeqyaaelqfriaapqgtkfwdptndfsyqgltrelaktkympvfdgatkifgevp
    gglehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5gxxB (B:)
    synyaealqkaiyfyecqqagplpewnrvewrgdatmndevlggwydagdhvkfnlpmay
    saamlgwalyeygddieasgqrlhlernlafaldylvacdrgdsvvyqigdgaadhkwwg
    saeviekemtrpyfvgkgsavvgqmaaalavgsivlkndtylryakkyfeladatrsdst
    ytaangfysshsgfwdellwastwlylatgdrnyldkaesytpklnrqnqttdieyqwah
    cwddchygamillaratgkeeyhkfaqmhldwwtpqgyngkrvaytpgglahldtwgplr
    yatteaflafvyadsindpalkqkyynfaksqidyalgsnpdnrsyvvgfgnnppqrphh
    rtahgtwldkrdipekhrhvlygalvggpgrddsyedniedyvknevacdynagfvgalc
    rltaeyggtplanfpppeqrddeffveaainqasdhfteikallnnrsswparlikdlsy
    nyymdltevfeagysvddikvtigycesgmdveispithlydniyyikisyidgtnicpi
    gqeqyaaelqfriaapqgtkfwdptndfsyqgltrelaktkympvfdgatkifgevpgg