PDB entry 5gx9

View 5gx9 on RCSB PDB site
Description: PYP mutant - E46Q
Class: signaling protein
Keywords: pas, lov, photoreceptor, light sensor, lbhb, shb, chromophore, photoreceptor protein, receptor, sensory transduction, signaling protein
Deposited on 2016-09-16, released 2017-08-30
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-09-13, with a file datestamp of 2017-09-08.
Experiment type: NEUT
Resolution: 1.49 Å
R-factor: N/A
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Photoactive yellow protein
    Species: HALORHODOSPIRA HALOPHILA [TaxId:1053]
    Gene: PYP
    Database cross-references and differences (RAF-indexed):
    • Uniprot P16113 (0-124)
      • engineered mutation (45)
    Domains in SCOPe 2.07: d5gx9a_
  • Heterogens: HC4, DOD

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5gx9A (A:)
    mehvafgsedientlakmddgqldglafgaiqldgdgnilqynaaqgditgrdpkqvigk
    nffkdvapctdspefygkfkegvasgnlntmfeytfdyqmtptkvkvhmkkalsgdsywv
    fvkrv