PDB entry 5gwx

View 5gwx on RCSB PDB site
Description: Crystal structure of glycine sarcosine N-methyltransferase from Methanohalophilus portucalensis in complex with S-adenosylmethionine and sarcosine
Class: transferase
Keywords: S-adenosylmethionine-dependent methyltransferases, SAM, AdoMet-MTase, class I monomethylation, glycine, sarcosine rate-limiting enzyme, betaine biosynthesis betaine-mediated feedback inhibition, TRANSFERASE
Deposited on 2016-09-14, released 2016-11-23
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-01-18, with a file datestamp of 2017-01-13.
Experiment type: XRAY
Resolution: 2.21 Å
R-factor: N/A
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Glycine sarcosine N-methyltransferase
    Species: Methanohalophilus portucalensis FDF-1 [TaxId:523843]
    Gene: gsmt
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5gwxa_
  • Heterogens: SAM, SAR, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5gwxA (A:)
    mgsshhhhhhssglvprgshmmnqygkqdfgdnpievresdhyeeeyvlgfvdkwdelid
    wesraesegdtiinilkergvkkvldvatgtgfnsvrllqagfdvvsadgsaemlvkafd
    nardhgylmrtvqadwrwmnkdihdkfdaivclgnsfthlfdegdrrkalaefyallkhd
    gvllldqrnydailddgysskhahyycgdtvsvypehvdeglarfkyefsdgsvynlnmf
    plrkdytrqllhevgfqeintlgdfketykedepdfflhvaekn
    

    Sequence, based on observed residues (ATOM records): (download)
    >5gwxA (A:)
    evresdhyeeeyvlgfvdkwdelidwesraesegdtiinilkergvkkvldvatgtgfns
    vrllqagfdvvsadgsaemlvkafdnardhgylmrtvqadwrwmnkdihdkfdaivclgn
    sfthlfdegdrrkalaefyallkhdgvllldqrnydailddgysskhahyycgdtvsvyp
    ehvdeglarfkyefsdgsvynlnmfplrkdytrqllhevgfqeintlgdfketykedepd
    fflhvaekn