PDB entry 5gws

View 5gws on RCSB PDB site
Description: 4-hydroxyisoleucine dehydrogenase complexed with NADH and succinate
Class: oxidoreductase
Keywords: NADH-dependent, short-chain, dehydrogenase, reductase, OXIDOREDUCTASE
Deposited on 2016-09-13, released 2017-10-25
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-08, with a file datestamp of 2017-11-03.
Experiment type: XRAY
Resolution: 2.35 Å
R-factor: N/A
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 4-hydroxyisolecuine dehydrogenase
    Species: Bacillus thuringiensis [TaxId:1428]
    Gene: AC241_05390
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5gwsa_
  • Chain 'B':
    Compound: 4-hydroxyisolecuine dehydrogenase
    Species: Bacillus thuringiensis [TaxId:1428]
    Gene: AC241_05390
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5gwsb_
  • Chain 'C':
    Compound: 4-hydroxyisolecuine dehydrogenase
    Species: Bacillus thuringiensis [TaxId:1428]
    Gene: AC241_05390
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5gwsc_
  • Chain 'D':
    Compound: 4-hydroxyisolecuine dehydrogenase
    Species: Bacillus thuringiensis [TaxId:1428]
    Gene: AC241_05390
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5gwsd_
  • Heterogens: NAD, SIN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5gwsA (A:)
    mrenkiimisgansgighacikyfleksfhvialdinnnnlidymktdmplkvvqidlsn
    seaihnlftqldleklspdilinaagireitpvlhlsddmfkkvidvnlvapfilsreva
    krwceskikgcivniasvsglmaeperaayvaskhaligltkqmamefgkqnirvnsisp
    gvirtelteeyfsnkalmsmiksnqsldtwglpqdivscieylisdqarfitgsnfvidg
    gwtagknllekgelnsklegkpipnpllgldstrtghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5gwsA (A:)
    iimisgansgighacikyfleksfhvialdinnnnlidymktdmplkvvqidlsnseaih
    nlftqldleklspdilinaagireitpvlhlsddmfkkvidvnlvapfilsrevakrwce
    skikgcivniasvsglmaeperaayvaskhaligltkqmamefgkqnirvnsispgvirt
    eltalmsmiksnqsldtwglpqdivscieylisdqarfitgsnfvidggwtag
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5gwsB (B:)
    mrenkiimisgansgighacikyfleksfhvialdinnnnlidymktdmplkvvqidlsn
    seaihnlftqldleklspdilinaagireitpvlhlsddmfkkvidvnlvapfilsreva
    krwceskikgcivniasvsglmaeperaayvaskhaligltkqmamefgkqnirvnsisp
    gvirtelteeyfsnkalmsmiksnqsldtwglpqdivscieylisdqarfitgsnfvidg
    gwtagknllekgelnsklegkpipnpllgldstrtghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5gwsB (B:)
    iimisgansgighacikyfleksfhvialdinnnnlmplkvvqidlsnseaihnlftqld
    leklspdilinaagireitpvlhlsddmfkkvidvnlvapfilsrevakrwceskikgci
    vniasvsglmaeperaayvaskhaligltkqmamefgkqnirvnsispgvisnqsldtwg
    lpqdivscieylisdqarfitgsnfvidggwtag
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5gwsC (C:)
    mrenkiimisgansgighacikyfleksfhvialdinnnnlidymktdmplkvvqidlsn
    seaihnlftqldleklspdilinaagireitpvlhlsddmfkkvidvnlvapfilsreva
    krwceskikgcivniasvsglmaeperaayvaskhaligltkqmamefgkqnirvnsisp
    gvirtelteeyfsnkalmsmiksnqsldtwglpqdivscieylisdqarfitgsnfvidg
    gwtagknllekgelnsklegkpipnpllgldstrtghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5gwsC (C:)
    iimisgansgighacikyfleksfhvialdinnnnlmplkvvqidlsnseaihnlftqld
    leklspdilinaagireitpvlhlsddmfkkvidvnlvapfilsrevakrwceskikgci
    vniasvsglmaeperaayvaskhaligltkqmamefgkqnirvnsispgvisnqsldtwg
    lpqdivscieylisdqarfitgsnfvidggwtag
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >5gwsD (D:)
    mrenkiimisgansgighacikyfleksfhvialdinnnnlidymktdmplkvvqidlsn
    seaihnlftqldleklspdilinaagireitpvlhlsddmfkkvidvnlvapfilsreva
    krwceskikgcivniasvsglmaeperaayvaskhaligltkqmamefgkqnirvnsisp
    gvirtelteeyfsnkalmsmiksnqsldtwglpqdivscieylisdqarfitgsnfvidg
    gwtagknllekgelnsklegkpipnpllgldstrtghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5gwsD (D:)
    iimisgansgighacikyfleksfhvialdinnnnlkvvqidlsnseaihnlftqldlek
    lspdilinaagireitpvlhlsddmfkkvidvnlvapfilsrevakrwceskikgcivni
    asvsglmaeperaayvaskhaligltkqmamefgkqnirvnsispgvisnqsldtwglpq
    divscieylisdqarfitgsnfvidggwtag