PDB entry 5gwk

View 5gwk on RCSB PDB site
Description: human topoisomerase iialpha in complex with dna and etoposide
Deposited on 2016-09-12, released 2017-08-23
The last revision was dated 2017-11-08, with a file datestamp of 2017-11-03.
Experiment type: XRAY
Resolution: 3.15 Å
R-factor: N/A
AEROSPACI score: 0.14 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: DNA topoisomerase 2-alpha
    Species: Homo sapiens [TaxId:9606]
    Gene: TOP2A, TOP2
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: DNA topoisomerase 2-alpha
    Species: Homo sapiens [TaxId:9606]
    Gene: TOP2A, TOP2
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: DNA (5'-d(p*ap*gp*cp*cp*gp*ap*gp*c)-3')
    Species: synthetic construct, synthetic [TaxId:32630]
  • Chain 'D':
    Compound: DNA (5'-d(p*tp*gp*cp*ap*gp*cp*tp*cp*gp*gp*cp*t)-3')
    Species: synthetic construct, synthetic [TaxId:32630]
  • Chain 'E':
    Compound: DNA (5'-d(p*ap*gp*cp*cp*gp*ap*gp*c)-3')
    Species: synthetic construct, synthetic [TaxId:32630]
  • Chain 'F':
    Compound: DNA (5'-d(p*tp*gp*cp*ap*gp*cp*tp*cp*gp*gp*cp*t)-3')
    Species: synthetic construct, synthetic [TaxId:32630]
  • Heterogens: MG, EVP

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >5gwkA (A:)
    maswshpqfekgaddddkvpdptsvdavkhnrikgipklddandaggrnstectlilteg
    dsaktlavsglgvvgrdkygvfplrgkilnvreashkqimenaeinniikivglqykkny
    ededslktlrygkimimtdqdqdgshikgllinfihhnwpsllrhrfleefitpivkvsk
    nkqemafyslpefeewksstpnhkkwkvkyykglgtstskeakeyfadmkrhriqfkysg
    peddaaislafskkqiddrkewltnfmedrrqrkllglpedylygqtttyltyndfinke
    lilfsnsdnersipsmvdglkpgqrkvlftcfkrndkrevkvaqlagsvaemssyhhgem
    slmmtiinlaqnfvgsnnlnllqpigqfgtrlhggkdsaspryiftmlsslarllfppkd
    dhtlkflyddnqrvepewyipiipmvlingaegigtgwsckipnfdvreivnnirrlmdg
    eeplpmlpsyknfkgtieelapnqyvisgevailnsttieiselpvrtwtqtykeqvlep
    mlngtektpplitdyreyhtdttvkfvvkmteeklaeaervglhkvfklqtsltcnsmvl
    fdhvgclkkydtvldilrdffelrlkyyglrkewllgmlgaesaklnnqarfilekidgk
    iiienkpkkelikvliqrgydsdpvkawkeaqqkvpdeeeneesdneketeksdsvtdsg
    ptfnylldmplwyltkekkdelcrlrnekeqeldtlkrkspsdlwkedlatfieeleave
    akekqdgapgfssisahhhhhhhhhh
    

    Sequence, based on observed residues (ATOM records):
    >5gwkA (A:)
    kgipklddandaggrnstectliltegdsaktlavsglgvvgrdkygvfplrgkilnvre
    ashkqimenaeinniikivglqykknyededslktlrygkimimtdqdqdgshikgllin
    fihhnwpsllrhrfleefitpivkvsknkqemafyslpefeewksstpnhkkwkvkyykg
    lgtstskeakeyfadmkrhriqfkysgpeddaaislafskkqiddrkewltnfmedrrqr
    kllglpedylygqtttyltyndfinkelilfsnsdnersipsmvdglkpgqrkvlftcfk
    rndkrevkvaqlagsvaemssyhhgemslmmtiinlaqnfvgsnnlnllqpigqfgtrlh
    ggkdsaspryiftmlsslarllfppkddhtlkflyddnqrvepewyipiipmvlingaeg
    igtgwsckipnfdvreivnnirrlmdgeeplpmlpsyknfkgtieelapnqyvisgevai
    lnsttieiselpvrtwtqtykeqvlepmlngtpplitdyreyhtdttvkfvvkmteekla
    eaervglhkvfklqtsltcnsmvlfdhvgclkkydtvldilrdffelrlkyyglrkewll
    gmlgaesaklnnqarfilekidgkiiienkpkkelikvliqrgydsdpvkawkeaqqsgp
    tfnylldmplwyltkekkdelcrlrnekeqeldtlkrkspsdlwkedlatfieeleavea
    kekq
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >5gwkB (B:)
    maswshpqfekgaddddkvpdptsvdavkhnrikgipklddandaggrnstectlilteg
    dsaktlavsglgvvgrdkygvfplrgkilnvreashkqimenaeinniikivglqykkny
    ededslktlrygkimimtdqdqdgshikgllinfihhnwpsllrhrfleefitpivkvsk
    nkqemafyslpefeewksstpnhkkwkvkyykglgtstskeakeyfadmkrhriqfkysg
    peddaaislafskkqiddrkewltnfmedrrqrkllglpedylygqtttyltyndfinke
    lilfsnsdnersipsmvdglkpgqrkvlftcfkrndkrevkvaqlagsvaemssyhhgem
    slmmtiinlaqnfvgsnnlnllqpigqfgtrlhggkdsaspryiftmlsslarllfppkd
    dhtlkflyddnqrvepewyipiipmvlingaegigtgwsckipnfdvreivnnirrlmdg
    eeplpmlpsyknfkgtieelapnqyvisgevailnsttieiselpvrtwtqtykeqvlep
    mlngtektpplitdyreyhtdttvkfvvkmteeklaeaervglhkvfklqtsltcnsmvl
    fdhvgclkkydtvldilrdffelrlkyyglrkewllgmlgaesaklnnqarfilekidgk
    iiienkpkkelikvliqrgydsdpvkawkeaqqkvpdeeeneesdneketeksdsvtdsg
    ptfnylldmplwyltkekkdelcrlrnekeqeldtlkrkspsdlwkedlatfieeleave
    akekqdgapgfssisahhhhhhhhhh
    

    Sequence, based on observed residues (ATOM records):
    >5gwkB (B:)
    kgipklddandaggrnstectliltegdsaktlavsglgvvgrdkygvfplrgkilnvre
    ashkqimenaeinniikivglqykknyededslktlrygkimimtdqdqdgshikgllin
    fihhnwpsllrhrfleefitpivkvsknkqemafyslpefeewksstpnhkkwkvkyykg
    lgtstskeakeyfadmkrhriqfkysgpeddaaislafskkqiddrkewltnfmedrrqr
    kllglpedylygqtttyltyndfinkelilfsnsdnersipsmvdglkpgqrkvlftcfk
    rndkrevkvaqlagsvaemssyhhgemslmmtiinlaqnfvgsnnlnllqpigqfgtrlh
    ggkdsaspryiftmlsslarllfppkddhtlkflyddnqrvepewyipiipmvlingaeg
    igtgwsckipnfdvreivnnirrlmdgeeplpmlpsyknfkgtieelapnqyvisgevai
    lnsttieiselpvrtwtqtykeqvlepmlngtpplitdyreyhtdttvkfvvkmteekla
    eaervglhkvfklqtsltcnsmvlfdhvgclkkydtvldilrdffelrlkyyglrkewll
    gmlgaesaklnnqarfilekidgkiiienkpkkelikvliqrgydsdpvkawkeaqqsgp
    tfnylldmplwyltkekkdelcrlrnekeqeldtlkrkspsdlwkedlatfieeleavea
    kekq
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.

  • Chain 'E':
    No sequence available.

  • Chain 'F':
    No sequence available.