PDB entry 5gwd

View 5gwd on RCSB PDB site
Description: structure of myroilysin
Deposited on 2016-09-10, released 2017-02-15
The last revision was dated 2017-10-18, with a file datestamp of 2017-10-13.
Experiment type: XRAY
Resolution: 1.89 Å
R-factor: N/A
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Myroilysin
    Species: Myroides sp. CSLB8 [TaxId:1736763]
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: Myroilysin
    Species: Myroides sp. CSLB8 [TaxId:1736763]
    Database cross-references and differences (RAF-indexed):
  • Heterogens: ZN, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >5gwdA (A:)
    mdsskglkelravpkadivsgfegakvckdvypkgtdprgavvrstkwpngsvitvglyg
    gtpyvrskvkqyaqewsnyanitfnfvesgtpqirvtftqgagsysylgtqalsipsnee
    tmnfgwfddstsdtefsrtvihefghalgmihehqhpltnipwdknkvyayyagypnyws
    kkdvdnnlfatysttqtqysaydtqsimhysissalttngfsvgnnsvlsatdkqfiatv
    yprnlehhhhhh
    

    Sequence, based on observed residues (ATOM records):
    >5gwdA (A:)
    glkelravpkadivsgfegakvckdvypkgtdprgavvrstkwpngsvitvglyggtpyv
    rskvkqyaqewsnyanitfnfvesgtpqirvtftqgagsysylgtqalsipsneetmnfg
    wfddstsdtefsrtvihefghalgmihehqhpltnipwdknkvyayyagypnywskkdvd
    nnlfatysttqtqysaydtqsimhysissalttngfsvgnnsvlsatdkqfiatvyprn
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >5gwdB (B:)
    mdsskglkelravpkadivsgfegakvckdvypkgtdprgavvrstkwpngsvitvglyg
    gtpyvrskvkqyaqewsnyanitfnfvesgtpqirvtftqgagsysylgtqalsipsnee
    tmnfgwfddstsdtefsrtvihefghalgmihehqhpltnipwdknkvyayyagypnyws
    kkdvdnnlfatysttqtqysaydtqsimhysissalttngfsvgnnsvlsatdkqfiatv
    yprnlehhhhhh
    

    Sequence, based on observed residues (ATOM records):
    >5gwdB (B:)
    glkelravpkadivsgfegakvckdvypkgtdprgavvrstkwpngsvitvglyggtpyv
    rskvkqyaqewsnyanitfnfvesgtpqirvtftqgagsysylgtqalsipsneetmnfg
    wfddstsdtefsrtvihefghalgmihehqhpltnipwdknkvyayyagypnywskkdvd
    nnlfatysttqtqysaydtqsimhysissalttngfsvgnnsvlsatdkqfiatvyprn