PDB entry 5gw5

View 5gw5 on RCSB PDB site
Description: structure of tric-amp-pnp
Deposited on 2016-09-08, released 2016-10-26
The last revision was dated 2017-12-13, with a file datestamp of 2017-12-08.
Experiment type: EM
Resolution: 4.6 Å
R-factor: N/A
AEROSPACI score: 0.05 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: T-complex protein 1 subunit alpha
    Species: Saccharomyces cerevisiae (strain ATCC 204508 / S288c) [TaxId:559292]
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: T-complex protein 1 subunit beta
    Species: Saccharomyces cerevisiae (strain ATCC 204508 / S288c) [TaxId:559292]
    Database cross-references and differences (RAF-indexed):
  • Chain 'D':
    Compound: T-complex protein 1 subunit delta
    Species: Saccharomyces cerevisiae (strain ATCC 204508 / S288c) [TaxId:559292]
    Database cross-references and differences (RAF-indexed):
  • Chain 'E':
    Compound: T-complex protein 1 subunit epsilon
    Species: Saccharomyces cerevisiae (strain ATCC 204508 / S288c) [TaxId:559292]
    Database cross-references and differences (RAF-indexed):
  • Chain 'G':
    Compound: t-complex protein 1 subunit gamma
    Species: Saccharomyces cerevisiae (strain ATCC 204508 / S288c) [TaxId:559292]
    Database cross-references and differences (RAF-indexed):
  • Chain 'H':
    Compound: T-complex protein 1 subunit eta
    Species: Saccharomyces cerevisiae (strain ATCC 204508 / S288c) [TaxId:559292]
    Database cross-references and differences (RAF-indexed):
  • Chain 'Q':
    Compound: T-complex protein 1 subunit theta
    Species: Saccharomyces cerevisiae (strain ATCC 204508 / S288c) [TaxId:559292]
    Database cross-references and differences (RAF-indexed):
  • Chain 'Z':
    Compound: T-complex protein 1 subunit zeta
    Species: Saccharomyces cerevisiae (strain ATCC 204508 / S288c) [TaxId:559292]
    Database cross-references and differences (RAF-indexed):
  • Chain 'a':
    Compound: T-complex protein 1 subunit alpha
    Species: Saccharomyces cerevisiae (strain ATCC 204508 / S288c) [TaxId:559292]
    Database cross-references and differences (RAF-indexed):
  • Chain 'b':
    Compound: T-complex protein 1 subunit beta
    Species: Saccharomyces cerevisiae (strain ATCC 204508 / S288c) [TaxId:559292]
    Database cross-references and differences (RAF-indexed):
  • Chain 'd':
    Compound: T-complex protein 1 subunit delta
    Species: Saccharomyces cerevisiae (strain ATCC 204508 / S288c) [TaxId:559292]
    Database cross-references and differences (RAF-indexed):
  • Chain 'e':
    Compound: T-complex protein 1 subunit epsilon
    Species: Saccharomyces cerevisiae (strain ATCC 204508 / S288c) [TaxId:559292]
    Database cross-references and differences (RAF-indexed):
  • Chain 'g':
    Compound: t-complex protein 1 subunit gamma
    Species: Saccharomyces cerevisiae (strain ATCC 204508 / S288c) [TaxId:559292]
    Database cross-references and differences (RAF-indexed):
  • Chain 'h':
    Compound: T-complex protein 1 subunit eta
    Species: Saccharomyces cerevisiae (strain ATCC 204508 / S288c) [TaxId:559292]
    Database cross-references and differences (RAF-indexed):
  • Chain 'q':
    Compound: T-complex protein 1 subunit theta
    Species: Saccharomyces cerevisiae (strain ATCC 204508 / S288c) [TaxId:559292]
    Database cross-references and differences (RAF-indexed):
  • Chain 'z':
    Compound: T-complex protein 1 subunit zeta
    Species: Saccharomyces cerevisiae (strain ATCC 204508 / S288c) [TaxId:559292]
    Database cross-references and differences (RAF-indexed):

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >5gw5A (A:)
    msqlfnnsrsdtlflggekisgddirnqnvlatmavanvvksslgpvgldkmlvddigdf
    tvtndgatilslldvqhpagkilvelaqqqdreigdgttsvviiasellkranelvknki
    hpttiitgfrvalreairfinevlstsvdtlgketliniaktsmsskiigadsdffsnmv
    vdallavktqnskgeikypvkavnvlkahgksatesllvpgyalnctvasqampkriagg
    nvkiacldlnlqkarmamgvqiniddpeqleqirkreagivlervkkiidagaqvvlttk
    giddlclkefveakimgvrrckkedlrriaratgatlvssmsnlegeetfessylglcde
    vvqakfsddecilikgtskhssssiilrgandysldemerslhdslsvvkrtlesgnvvp
    gggcveaalniyldnfattvgsreqlaiaefaaalliipktlavnaakdsselvaklrsy
    haasqmakpedvkrrsyrnygldlirgkivdeihagvleptiskvkslksaleacvailr
    idtmitvdpeppkedphdh
    

    Sequence, based on observed residues (ATOM records):
    >5gw5A (A:)
    fnnsrsdtlflggekisgddirnqnvlatmavanvvksslgpvgldkmlvddigdftvtn
    dgatilslldvqhpagkilvelaqqqdreigdgttsvviiasellkranelvknkihptt
    iitgfrvalreairfinevlstsvdtlgketliniaktsmsskiigadsdffsnmvvdal
    lavktqnskgeikypvkavnvlkahgksatesllvpgyalnctvasqampkriaggnvki
    acldlnlqkarmamgvqiniddpeqleqirkreagivlervkkiidagaqvvlttkgidd
    lclkefveakimgvrrckkedlrriaratgatlvssmsnlegeetfessylglcdevvqa
    kfsddecilikgtskhssssiilrgandysldemerslhdslsvvkrtlesgnvvpgggc
    veaalniyldnfattvgsreqlaiaefaaalliipktlavnaakdsselvaklrsyhaas
    qmakpedvkrrsyrnygldlirgkivdeihagvleptiskvkslksaleacvailridtm
    itv
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >5gw5B (B:)
    msvqifgdqvteeraenarlsafvgaiavgdlvkstlgpkgmdkllqsassntcmvtndg
    atilksipldnpaakvlvniskvqddevgdgttsvtvlsaellreaeklidqskihpqti
    iegyrlasaaaldaltkaavdnshdktmfredlihiakttlsskilsqdkdhfaelatna
    ilrlkgstnlehiqiikilggklsdsfldegfilakkfgnnqpkrienakilianttldt
    dkvkifgtkfkvdstaklaqlekaerekmknkiakiskfgintfinrqliydypeqlftd
    lginsiehadfegverlalvtggevvstfdepskcklgecdvieeimlgeqpflkfsgck
    ageactivlrgatdqtldeaerslhdalsvlsqttketrtvlgggcaemvmskavdteaq
    nidgkkslaveafaralrqlptiladnagfdsselvsklrssiyngistsgldlnngtia
    dmrqlgivesyklkravvssaseaaevllrvdniirarprtanrqhm
    

    Sequence, based on observed residues (ATOM records):
    >5gw5B (B:)
    qifgdqvteeraenarlsafvgaiavgdlvkstlgpkgmdkllqsassntcmvtndgati
    lksipldnpaakvlvniskvqddevgdgttsvtvlsaellreaeklidqskihpqtiieg
    yrlasaaaldaltkaavdnshdktmfredlihiakttlsskilsqdkdhfaelatnailr
    lkgstnlehiqiikilggklsdsfldegfilakkfgnnqpkrienakilianttldtdkv
    kifgtkfkvdstaklaqlekaerekmknkiakiskfgintfinrqliydypeqlftdlgi
    nsiehadfegverlalvtggevvstfdepskcklgecdvieeimlgeqpflkfsgckage
    activlrgatdqtldeaerslhdalsvlsqttketrtvlgggcaemvmskavdteaqnid
    gkkslaveafaralrqlptiladnagfdsselvsklrssiyngistsgldlnngtiadmr
    qlgivesyklkravvssaseaaevllrvdniirarpr
    

  • Chain 'D':
    Sequence, based on SEQRES records:
    >5gw5D (D:)
    msakvpsnatfknkekpqevrkaniiaarsvadairtslgpkgmdkmiktsrgeiiisnd
    ghtilkqmailhpvarmlvevsaaqdseagdgttsvviltgallgaaerllnkgihptii
    adsfqsaakrsvdillemchkvslsdreqlvraastslsskivsqyssflaplavdsvlk
    isdensknvdlndirlvkkvggtiddtemidgvvltqtaiksaggptrkekakigliqfq
    isppkpdtenniivndyrqmdkilkeerayllnickkikkakcnvlliqksilrdavndl
    alhflsklnimvvkdiereeieflskglgckpiadielftedrlgsadlveeidsdgski
    vrvtgirnnnarptvsvvirgannmiideterslhdalcvirclvkergliagggapeie
    isrrlskearsmegvqafiwqefasalevipttlaenaglnsikvvtelrskhengelnd
    gisvrrsgttntyeehilqpvlvstsaitlasecvksilriddiafsr
    

    Sequence, based on observed residues (ATOM records):
    >5gw5D (D:)
    natfknkekpqevrkaniiaarsvadairtslgpkgmdkmiktsrgeiiisndghtilkq
    mailhpvarmlvevsaaqdseagdgttsvviltgallgaaerllnkgihptiiadsfqsa
    akrsvdillemchkvslsdreqlvraastslsskivsqyssflaplavdsvlkisdensk
    nvdlndirlvkkvggtiddtemidgvvltqtaiksaggptrkekakigliqfqisppkpd
    tenniivndyrqmdkilkeerayllnickkikkakcnvlliqksilrdavndlalhflsk
    lnimvvkdiereeieflskglgckpiadielftedrlgsadlveeidsdgskivrvtgir
    nnnarptvsvvirgannmiideterslhdalcvirclvkergliagggapeieisrrlsk
    earsmegvqafiwqefasalevipttlaenaglnsikvvtelrskhengelndgisvrrs
    gttntyeehilqpvlvstsaitlasecvksilriddiafsr
    

  • Chain 'E':
    Sequence, based on SEQRES records:
    >5gw5E (E:)
    maarpqqppmempdlsnaivaqdemgrpfiivkdqgnkkrqhgleakkshilaarsvasi
    iktslgprgldkilispdgeititndgatilsqmeldneiakllvqlsksqddeigdgtt
    gvvvlasalldqaleliqkgihpikiangfdeaaklaiskleetcddisasndelfrdfl
    lraaktslgskivskdhdrfaemaveavinvmdkdrkdvdfdlikmqgrvggsisdskli
    ngvildkdfshpqmpkcvlpkegsdgvklailtcpfeppkpktkhkldissveeyqklqt
    yeqdkfkemiddvkkagadvvicqwgfddeanhlllqndlpavrwvggqelehiaistng
    rivprfqdlskdklgtcsriyeqefgttkdrmliieqsketktvtcfvrgsnkmivdeae
    ralhdslcvvrnlvkdsrvvygggaaevtmslavseeadkqrgidqyafrgfaqaldtip
    mtlaensgldpigtlstlkskqlkekisnigvdclgygsndmkelfvvdpfigkkqqill
    atqlcrmilkidnviisgkdey
    

    Sequence, based on observed residues (ATOM records):
    >5gw5E (E:)
    kdqgnkkrqhgleakkshilaarsvasiiktslgprgldkilispdgeititndgatils
    qmeldneiakllvqlsksqddeigdgttgvvvlasalldqaleliqkgihpikiangfde
    aaklaiskleetcddisasndelfrdfllraaktslgskivskdhdrfaemaveavinvm
    dkdrkdvdfdlikmqgrvggsisdsklingvildkdfshpqmpkcvlpkegsdgvklail
    tcpfeppkpktkhkldissveeyqklqtyeqdkfkemiddvkkagadvvicqwgfddean
    hlllqndlpavrwvggqelehiaistngrivprfqdlskdklgtcsriyeqefgttkdrm
    liieqsketktvtcfvrgsnkmivdeaeralhdslcvvrnlvkdsrvvygggaaevtmsl
    avseeadkqrgidqyafrgfaqaldtipmtlaensgldpigtlstlkskqlkekisnigv
    dclgygsndmkelfvvdpfigkkqqillatqlcrmilkidnviisgkd
    

  • Chain 'G':
    Sequence, based on SEQRES records:
    >5gw5G (G:)
    mqapvvfmnasqerttgrqaqisnitaakavadvirtclgpkamlkmlldpmgglvltnd
    ghailreidvahpaaksmlelsrtqdeevgdgtttviilageilaqcapylieknihpvi
    iiqalkkaltdalevikqvskpvdvendaamkkliqasigtkyvihwsekmcelaldavk
    tvrkdlgqtvegepnfeidikryvrvekipggdvldsrvlkgvllnkdvvhpkmsrhien
    prvvlldcpleykkgesqtnieiekeedwnrilqieeeqvqlmceqilavrptlvitekg
    vsdlaqhyllkggcsvlrrvkksdnnriarvtgativnrvedlkesdvgtncglfkvemi
    gdeyfsfldnckepkactimlrggskdilneidrnlqdamavarnvmlspslspgggate
    mavsvklaekakqlegiqqwpyqavadameciprtliqnaggdpirllsqlrakhaqgnf
    ttgidgdkgkivdmvsygiwepevikqqsvktaiesaclllrvddivsgvrkqe
    

    Sequence, based on observed residues (ATOM records):
    >5gw5G (G:)
    erttgrqaqisnitaakavadvirtclgpkamlkmlldpmgglvltndghailreidvah
    paaksmlelsrtqdeevgdgtttviilageilaqcapylieknihpviiiqalkkaltda
    levikqvskpvdvendaamkkliqasigtkyvihwsekmcelaldavktvrkdlgqtveg
    epnfeidikryvrvekipggdvldsrvlkgvllnkdvvhpkmsrhienprvvlldcpley
    kkgesqtnieiekeedwnrilqieeeqvqlmceqilavrptlvitekgvsdlaqhyllkg
    gcsvlrrvkksdnnriarvtgativnrvedlkesdvgtncglfkvemigdeyfsfldnck
    epkactimlrggskdilneidrnlqdamavarnvmlspslspgggatemavsvklaekak
    qlegiqqwpyqavadameciprtliqnaggdpirllsqlrakhaqgnfttgidgdkgkiv
    dmvsygiwepevikqqsvktaiesaclllrvddivsgv
    

  • Chain 'H':
    Sequence, based on SEQRES records:
    >5gw5H (H:)
    mnfgsqtptivvlkegtdasqgkgqiisninacvavqealkptlgplgsdilivtsnqkt
    tisndgatilklldvvhpaaktlvdisraqdaevgdgttsvtilagelmkeakpfleegi
    sshlimkgyrkavslavekinelavditsekssgrellercartamssklihnnadffvk
    mcvdavlsldrndlddkligikkipggameeslfingvafkktfsyagfeqqpkkfnnpk
    ilslnvelelkaekdnaevrvehvedyqaivdaewqlifeklrqveetganivlsklpig
    dlatqffadrnifcagrvsaddmnrviqavggsiqsttsdikpehlgtcalfeemqigse
    rynlfqgcpqaktctlllrggaeqviaeverslhdaimivkralqnklivagggatemev
    skclrdysktiagkqqmiinafakaleviprqlcenagfdaieilnklrlahskgekwyg
    vvfetenigdnfakfvwepalvkinalnsateatnlilsvdetitnkgsesanagmmppq
    gagrgrgmpm
    

    Sequence, based on observed residues (ATOM records):
    >5gw5H (H:)
    ivvlkegtdasqgkgqiisninacvavqealkptlgplgsdilivtsnqkttisndgati
    lklldvvhpaaktlvdisraqdaevgdgttsvtilagelmkeakpfleegisshlimkgy
    rkavslavekinelavditsekssgrellercartamssklihnnadffvkmcvdavlsl
    drndlddkligikkipggameeslfingvafkktfsyagfeqqpkkfnnpkilslnvele
    lkaekdnaevrvehvedyqaivdaewqlifeklrqveetganivlsklpigdlatqffad
    rnifcagrvsaddmnrviqavggsiqsttsdikpehlgtcalfeemqigserynlfqgcp
    qaktctlllrggaeqviaeverslhdaimivkralqnklivagggatemevskclrdysk
    tiagkqqmiinafakaleviprqlcenagfdaieilnklrlahskgekwygvvfetenig
    dnfakfvwepalvkinalnsateatnlilsvdetitnkg
    

  • Chain 'Q':
    Sequence, based on SEQRES records:
    >5gw5Q (Q:)
    mslrlpqnpnaglfkqgynsysnadgqiiksiaairelhqmcltsmgpcgrnkiivnhlg
    kiiitndaatmlreldivhpavkvlvmateqqkidmgdgtnlvmilagellnvseklism
    glsaveiiqgynmarkftlkeldemvvgeitdkndknellkmikpvisskkygsedilse
    lvseavshvlpvaqqageipyfnvdsirvvkimggslsnstvikgmvfnrepeghvksls
    edkkhkvavftcpldiantetkgtvllhnaqemldfskgeekqidammkeiadmgveciv
    agagvgelalhylnrygilvlkvpskfelrrlcrvcgatplprlgaptpeelglvetvkt
    meiggdrvtvfkqeqgeisrtstiilrgatqnnlddieraiddgvaavkglmkpsggkll
    pgagateielisritkygertpgllqlaikqfavafevvprtlaetagldvnevlpnlya
    ahnvtepgavktdhlykgvdidgesdegvkdireeniydmlatkkfainvateaattvls
    idqiimakkaggprapqgprpgnwdqed
    

    Sequence, based on observed residues (ATOM records):
    >5gw5Q (Q:)
    qnpnaglfkqgynsysnadgqiiksiaairelhqmcltsmgpcgrnkiivnhlgkiiitn
    daatmlreldivhpavkvlvmateqqkidmgdgtnlvmilagellnvseklismglsave
    iiqgynmarkftlkeldemvvgeitdkndknellkmikpvisskkygsedilselvseav
    shvlpvaqqageipyfnvdsirvvkimggslsnstvikgmvfnrepeghvkslsedkkhk
    vavftcpldiantetkgtvllhnaqemldfskgeekqidammkeiadmgvecivagagvg
    elalhylnrygilvlkvpskfelrrlcrvcgatplprlgaptpeelglvetvktmeiggd
    rvtvfkqeqgeisrtstiilrgatqnnlddieraiddgvaavkglmkpsggkllpgagat
    eielisritkygertpgllqlaikqfavafevvprtlaetagldvnevlpnlyaahnvte
    pgavktdhlykgvdidgesdegvkdireeniydmlatkkfainvateaattvlsidqiim
    akk
    

  • Chain 'Z':
    Sequence, based on SEQRES records:
    >5gw5Z (Z:)
    mslqllnpkaeslrrdaalkvnvtsaeglqsvletnlgpkgtlkmlvdgagnikltkdgk
    vlltemqiqsptavliaraaaaqdeitgdgtttvvclvgellrqahrfiqegvhpriitd
    gfeiarkesmkfldefkisktnlsndrefllqvarsslltkvdadltevltpivtdavls
    vydaqadnldlhmveimqmqhlspkdttfikglvldhggrhpdmptrvknayvlilnvsl
    eyektevnsgffyssadqrdklaaserkfvdaklkkiidlknevcgmdpdkgfviinqkg
    idpmsldvfakhnilalrrakrrnmerlqlvtggeaqnsvedlspqilgfsglvyqetig
    eekftyvtentdpksctilikgsthyalaqtkdavrdglravanvlkdkniipgagafyi
    alsrylrsanmnklgakgktktgieafaeallvipktlvknsgfdpldvlamvedeldda
    qdsdetryvgvdlnigdscdptiegiwdsyrvlrnaitgatgiasnlllcdellragrst
    lketpq
    

    Sequence, based on observed residues (ATOM records):
    >5gw5Z (Z:)
    llnpkaeslrrdaalkvnvtsaeglqsvletnlgpkgtlkmlvdgagnikltkdgkvllt
    emqiqsptavliaraaaaqdeitgdgtttvvclvgellrqahrfiqegvhpriitdgfei
    arkesmkfldefkisktnlsndrefllqvarsslltkvdadltevltpivtdavlsvyda
    qadnldlhmveimqmqhlspkdttfikglvldhggrhpdmptrvknayvlilnvsleyek
    tevnsgffyssadqrdklaaserkfvdaklkkiidlknevcgmdpdkgfviinqkgidpm
    sldvfakhnilalrrakrrnmerlqlvtggeaqnsvedlspqilgfsglvyqetigeekf
    tyvtentdpksctilikgsthyalaqtkdavrdglravanvlkdkniipgagafyialsr
    ylrsanmnklgakgktktgieafaeallvipktlvknsgfdpldvlamvedelddaqdsd
    etryvgvdlnigdscdptiegiwdsyrvlrnaitgatgiasnlllcdellragr
    

  • Chain 'a':
    Sequence, based on SEQRES records:
    >5gw5a (a:)
    msqlfnnsrsdtlflggekisgddirnqnvlatmavanvvksslgpvgldkmlvddigdf
    tvtndgatilslldvqhpagkilvelaqqqdreigdgttsvviiasellkranelvknki
    hpttiitgfrvalreairfinevlstsvdtlgketliniaktsmsskiigadsdffsnmv
    vdallavktqnskgeikypvkavnvlkahgksatesllvpgyalnctvasqampkriagg
    nvkiacldlnlqkarmamgvqiniddpeqleqirkreagivlervkkiidagaqvvlttk
    giddlclkefveakimgvrrckkedlrriaratgatlvssmsnlegeetfessylglcde
    vvqakfsddecilikgtskhssssiilrgandysldemerslhdslsvvkrtlesgnvvp
    gggcveaalniyldnfattvgsreqlaiaefaaalliipktlavnaakdsselvaklrsy
    haasqmakpedvkrrsyrnygldlirgkivdeihagvleptiskvkslksaleacvailr
    idtmitvdpeppkedphdh
    

    Sequence, based on observed residues (ATOM records):
    >5gw5a (a:)
    fnnsrsdtlflggekisgddirnqnvlatmavanvvksslgpvgldkmlvddigdftvtn
    dgatilslldvqhpagkilvelaqqqdreigdgttsvviiasellkranelvknkihptt
    iitgfrvalreairfinevlstsvdtlgketliniaktsmsskiigadsdffsnmvvdal
    lavktqnskgeikypvkavnvlkahgksatesllvpgyalnctvasqampkriaggnvki
    acldlnlqkarmamgvqiniddpeqleqirkreagivlervkkiidagaqvvlttkgidd
    lclkefveakimgvrrckkedlrriaratgatlvssmsnlegeetfessylglcdevvqa
    kfsddecilikgtskhssssiilrgandysldemerslhdslsvvkrtlesgnvvpgggc
    veaalniyldnfattvgsreqlaiaefaaalliipktlavnaakdsselvaklrsyhaas
    qmakpedvkrrsyrnygldlirgkivdeihagvleptiskvkslksaleacvailridtm
    itv
    

  • Chain 'b':
    Sequence, based on SEQRES records:
    >5gw5b (b:)
    msvqifgdqvteeraenarlsafvgaiavgdlvkstlgpkgmdkllqsassntcmvtndg
    atilksipldnpaakvlvniskvqddevgdgttsvtvlsaellreaeklidqskihpqti
    iegyrlasaaaldaltkaavdnshdktmfredlihiakttlsskilsqdkdhfaelatna
    ilrlkgstnlehiqiikilggklsdsfldegfilakkfgnnqpkrienakilianttldt
    dkvkifgtkfkvdstaklaqlekaerekmknkiakiskfgintfinrqliydypeqlftd
    lginsiehadfegverlalvtggevvstfdepskcklgecdvieeimlgeqpflkfsgck
    ageactivlrgatdqtldeaerslhdalsvlsqttketrtvlgggcaemvmskavdteaq
    nidgkkslaveafaralrqlptiladnagfdsselvsklrssiyngistsgldlnngtia
    dmrqlgivesyklkravvssaseaaevllrvdniirarprtanrqhm
    

    Sequence, based on observed residues (ATOM records):
    >5gw5b (b:)
    qifgdqvteeraenarlsafvgaiavgdlvkstlgpkgmdkllqsassntcmvtndgati
    lksipldnpaakvlvniskvqddevgdgttsvtvlsaellreaeklidqskihpqtiieg
    yrlasaaaldaltkaavdnshdktmfredlihiakttlsskilsqdkdhfaelatnailr
    lkgstnlehiqiikilggklsdsfldegfilakkfgnnqpkrienakilianttldtdkv
    kifgtkfkvdstaklaqlekaerekmknkiakiskfgintfinrqliydypeqlftdlgi
    nsiehadfegverlalvtggevvstfdepskcklgecdvieeimlgeqpflkfsgckage
    activlrgatdqtldeaerslhdalsvlsqttketrtvlgggcaemvmskavdteaqnid
    gkkslaveafaralrqlptiladnagfdsselvsklrssiyngistsgldlnngtiadmr
    qlgivesyklkravvssaseaaevllrvdniirarpr
    

  • Chain 'd':
    Sequence, based on SEQRES records:
    >5gw5d (d:)
    msakvpsnatfknkekpqevrkaniiaarsvadairtslgpkgmdkmiktsrgeiiisnd
    ghtilkqmailhpvarmlvevsaaqdseagdgttsvviltgallgaaerllnkgihptii
    adsfqsaakrsvdillemchkvslsdreqlvraastslsskivsqyssflaplavdsvlk
    isdensknvdlndirlvkkvggtiddtemidgvvltqtaiksaggptrkekakigliqfq
    isppkpdtenniivndyrqmdkilkeerayllnickkikkakcnvlliqksilrdavndl
    alhflsklnimvvkdiereeieflskglgckpiadielftedrlgsadlveeidsdgski
    vrvtgirnnnarptvsvvirgannmiideterslhdalcvirclvkergliagggapeie
    isrrlskearsmegvqafiwqefasalevipttlaenaglnsikvvtelrskhengelnd
    gisvrrsgttntyeehilqpvlvstsaitlasecvksilriddiafsr
    

    Sequence, based on observed residues (ATOM records):
    >5gw5d (d:)
    natfknkekpqevrkaniiaarsvadairtslgpkgmdkmiktsrgeiiisndghtilkq
    mailhpvarmlvevsaaqdseagdgttsvviltgallgaaerllnkgihptiiadsfqsa
    akrsvdillemchkvslsdreqlvraastslsskivsqyssflaplavdsvlkisdensk
    nvdlndirlvkkvggtiddtemidgvvltqtaiksaggptrkekakigliqfqisppkpd
    tenniivndyrqmdkilkeerayllnickkikkakcnvlliqksilrdavndlalhflsk
    lnimvvkdiereeieflskglgckpiadielftedrlgsadlveeidsdgskivrvtgir
    nnnarptvsvvirgannmiideterslhdalcvirclvkergliagggapeieisrrlsk
    earsmegvqafiwqefasalevipttlaenaglnsikvvtelrskhengelndgisvrrs
    gttntyeehilqpvlvstsaitlasecvksilriddiafsr
    

  • Chain 'e':
    Sequence, based on SEQRES records:
    >5gw5e (e:)
    maarpqqppmempdlsnaivaqdemgrpfiivkdqgnkkrqhgleakkshilaarsvasi
    iktslgprgldkilispdgeititndgatilsqmeldneiakllvqlsksqddeigdgtt
    gvvvlasalldqaleliqkgihpikiangfdeaaklaiskleetcddisasndelfrdfl
    lraaktslgskivskdhdrfaemaveavinvmdkdrkdvdfdlikmqgrvggsisdskli
    ngvildkdfshpqmpkcvlpkegsdgvklailtcpfeppkpktkhkldissveeyqklqt
    yeqdkfkemiddvkkagadvvicqwgfddeanhlllqndlpavrwvggqelehiaistng
    rivprfqdlskdklgtcsriyeqefgttkdrmliieqsketktvtcfvrgsnkmivdeae
    ralhdslcvvrnlvkdsrvvygggaaevtmslavseeadkqrgidqyafrgfaqaldtip
    mtlaensgldpigtlstlkskqlkekisnigvdclgygsndmkelfvvdpfigkkqqill
    atqlcrmilkidnviisgkdey
    

    Sequence, based on observed residues (ATOM records):
    >5gw5e (e:)
    kdqgnkkrqhgleakkshilaarsvasiiktslgprgldkilispdgeititndgatils
    qmeldneiakllvqlsksqddeigdgttgvvvlasalldqaleliqkgihpikiangfde
    aaklaiskleetcddisasndelfrdfllraaktslgskivskdhdrfaemaveavinvm
    dkdrkdvdfdlikmqgrvggsisdsklingvildkdfshpqmpkcvlpkegsdgvklail
    tcpfeppkpktkhkldissveeyqklqtyeqdkfkemiddvkkagadvvicqwgfddean
    hlllqndlpavrwvggqelehiaistngrivprfqdlskdklgtcsriyeqefgttkdrm
    liieqsketktvtcfvrgsnkmivdeaeralhdslcvvrnlvkdsrvvygggaaevtmsl
    avseeadkqrgidqyafrgfaqaldtipmtlaensgldpigtlstlkskqlkekisnigv
    dclgygsndmkelfvvdpfigkkqqillatqlcrmilkidnviisgkd
    

  • Chain 'g':
    Sequence, based on SEQRES records:
    >5gw5g (g:)
    mqapvvfmnasqerttgrqaqisnitaakavadvirtclgpkamlkmlldpmgglvltnd
    ghailreidvahpaaksmlelsrtqdeevgdgtttviilageilaqcapylieknihpvi
    iiqalkkaltdalevikqvskpvdvendaamkkliqasigtkyvihwsekmcelaldavk
    tvrkdlgqtvegepnfeidikryvrvekipggdvldsrvlkgvllnkdvvhpkmsrhien
    prvvlldcpleykkgesqtnieiekeedwnrilqieeeqvqlmceqilavrptlvitekg
    vsdlaqhyllkggcsvlrrvkksdnnriarvtgativnrvedlkesdvgtncglfkvemi
    gdeyfsfldnckepkactimlrggskdilneidrnlqdamavarnvmlspslspgggate
    mavsvklaekakqlegiqqwpyqavadameciprtliqnaggdpirllsqlrakhaqgnf
    ttgidgdkgkivdmvsygiwepevikqqsvktaiesaclllrvddivsgvrkqe
    

    Sequence, based on observed residues (ATOM records):
    >5gw5g (g:)
    erttgrqaqisnitaakavadvirtclgpkamlkmlldpmgglvltndghailreidvah
    paaksmlelsrtqdeevgdgtttviilageilaqcapylieknihpviiiqalkkaltda
    levikqvskpvdvendaamkkliqasigtkyvihwsekmcelaldavktvrkdlgqtveg
    epnfeidikryvrvekipggdvldsrvlkgvllnkdvvhpkmsrhienprvvlldcpley
    kkgesqtnieiekeedwnrilqieeeqvqlmceqilavrptlvitekgvsdlaqhyllkg
    gcsvlrrvkksdnnriarvtgativnrvedlkesdvgtncglfkvemigdeyfsfldnck
    epkactimlrggskdilneidrnlqdamavarnvmlspslspgggatemavsvklaekak
    qlegiqqwpyqavadameciprtliqnaggdpirllsqlrakhaqgnfttgidgdkgkiv
    dmvsygiwepevikqqsvktaiesaclllrvddivsgv
    

  • Chain 'h':
    Sequence, based on SEQRES records:
    >5gw5h (h:)
    mnfgsqtptivvlkegtdasqgkgqiisninacvavqealkptlgplgsdilivtsnqkt
    tisndgatilklldvvhpaaktlvdisraqdaevgdgttsvtilagelmkeakpfleegi
    sshlimkgyrkavslavekinelavditsekssgrellercartamssklihnnadffvk
    mcvdavlsldrndlddkligikkipggameeslfingvafkktfsyagfeqqpkkfnnpk
    ilslnvelelkaekdnaevrvehvedyqaivdaewqlifeklrqveetganivlsklpig
    dlatqffadrnifcagrvsaddmnrviqavggsiqsttsdikpehlgtcalfeemqigse
    rynlfqgcpqaktctlllrggaeqviaeverslhdaimivkralqnklivagggatemev
    skclrdysktiagkqqmiinafakaleviprqlcenagfdaieilnklrlahskgekwyg
    vvfetenigdnfakfvwepalvkinalnsateatnlilsvdetitnkgsesanagmmppq
    gagrgrgmpm
    

    Sequence, based on observed residues (ATOM records):
    >5gw5h (h:)
    ivvlkegtdasqgkgqiisninacvavqealkptlgplgsdilivtsnqkttisndgati
    lklldvvhpaaktlvdisraqdaevgdgttsvtilagelmkeakpfleegisshlimkgy
    rkavslavekinelavditsekssgrellercartamssklihnnadffvkmcvdavlsl
    drndlddkligikkipggameeslfingvafkktfsyagfeqqpkkfnnpkilslnvele
    lkaekdnaevrvehvedyqaivdaewqlifeklrqveetganivlsklpigdlatqffad
    rnifcagrvsaddmnrviqavggsiqsttsdikpehlgtcalfeemqigserynlfqgcp
    qaktctlllrggaeqviaeverslhdaimivkralqnklivagggatemevskclrdysk
    tiagkqqmiinafakaleviprqlcenagfdaieilnklrlahskgekwygvvfetenig
    dnfakfvwepalvkinalnsateatnlilsvdetitnkg
    

  • Chain 'q':
    Sequence, based on SEQRES records:
    >5gw5q (q:)
    mslrlpqnpnaglfkqgynsysnadgqiiksiaairelhqmcltsmgpcgrnkiivnhlg
    kiiitndaatmlreldivhpavkvlvmateqqkidmgdgtnlvmilagellnvseklism
    glsaveiiqgynmarkftlkeldemvvgeitdkndknellkmikpvisskkygsedilse
    lvseavshvlpvaqqageipyfnvdsirvvkimggslsnstvikgmvfnrepeghvksls
    edkkhkvavftcpldiantetkgtvllhnaqemldfskgeekqidammkeiadmgveciv
    agagvgelalhylnrygilvlkvpskfelrrlcrvcgatplprlgaptpeelglvetvkt
    meiggdrvtvfkqeqgeisrtstiilrgatqnnlddieraiddgvaavkglmkpsggkll
    pgagateielisritkygertpgllqlaikqfavafevvprtlaetagldvnevlpnlya
    ahnvtepgavktdhlykgvdidgesdegvkdireeniydmlatkkfainvateaattvls
    idqiimakkaggprapqgprpgnwdqed
    

    Sequence, based on observed residues (ATOM records):
    >5gw5q (q:)
    qnpnaglfkqgynsysnadgqiiksiaairelhqmcltsmgpcgrnkiivnhlgkiiitn
    daatmlreldivhpavkvlvmateqqkidmgdgtnlvmilagellnvseklismglsave
    iiqgynmarkftlkeldemvvgeitdkndknellkmikpvisskkygsedilselvseav
    shvlpvaqqageipyfnvdsirvvkimggslsnstvikgmvfnrepeghvkslsedkkhk
    vavftcpldiantetkgtvllhnaqemldfskgeekqidammkeiadmgvecivagagvg
    elalhylnrygilvlkvpskfelrrlcrvcgatplprlgaptpeelglvetvktmeiggd
    rvtvfkqeqgeisrtstiilrgatqnnlddieraiddgvaavkglmkpsggkllpgagat
    eielisritkygertpgllqlaikqfavafevvprtlaetagldvnevlpnlyaahnvte
    pgavktdhlykgvdidgesdegvkdireeniydmlatkkfainvateaattvlsidqiim
    akk
    

  • Chain 'z':
    Sequence, based on SEQRES records:
    >5gw5z (z:)
    mslqllnpkaeslrrdaalkvnvtsaeglqsvletnlgpkgtlkmlvdgagnikltkdgk
    vlltemqiqsptavliaraaaaqdeitgdgtttvvclvgellrqahrfiqegvhpriitd
    gfeiarkesmkfldefkisktnlsndrefllqvarsslltkvdadltevltpivtdavls
    vydaqadnldlhmveimqmqhlspkdttfikglvldhggrhpdmptrvknayvlilnvsl
    eyektevnsgffyssadqrdklaaserkfvdaklkkiidlknevcgmdpdkgfviinqkg
    idpmsldvfakhnilalrrakrrnmerlqlvtggeaqnsvedlspqilgfsglvyqetig
    eekftyvtentdpksctilikgsthyalaqtkdavrdglravanvlkdkniipgagafyi
    alsrylrsanmnklgakgktktgieafaeallvipktlvknsgfdpldvlamvedeldda
    qdsdetryvgvdlnigdscdptiegiwdsyrvlrnaitgatgiasnlllcdellragrst
    lketpq
    

    Sequence, based on observed residues (ATOM records):
    >5gw5z (z:)
    llnpkaeslrrdaalkvnvtsaeglqsvletnlgpkgtlkmlvdgagnikltkdgkvllt
    emqiqsptavliaraaaaqdeitgdgtttvvclvgellrqahrfiqegvhpriitdgfei
    arkesmkfldefkisktnlsndrefllqvarsslltkvdadltevltpivtdavlsvyda
    qadnldlhmveimqmqhlspkdttfikglvldhggrhpdmptrvknayvlilnvsleyek
    tevnsgffyssadqrdklaaserkfvdaklkkiidlknevcgmdpdkgfviinqkgidpm
    sldvfakhnilalrrakrrnmerlqlvtggeaqnsvedlspqilgfsglvyqetigeekf
    tyvtentdpksctilikgsthyalaqtkdavrdglravanvlkdkniipgagafyialsr
    ylrsanmnklgakgktktgieafaeallvipktlvknsgfdpldvlamvedelddaqdsd
    etryvgvdlnigdscdptiegiwdsyrvlrnaitgatgiasnlllcdellragr