PDB entry 5gvy

View 5gvy on RCSB PDB site
Description: Crystal structure of SALT protein from Oryza sativa
Class: sugar binding protein
Keywords: Salt tolerance, Rice, Mannose binding lectin, SUGAR BINDING PROTEIN
Deposited on 2016-09-07, released 2017-09-13
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-07-29, with a file datestamp of 2020-07-02.
Experiment type: XRAY
Resolution: 1.66 Å
R-factor: N/A
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Salt stress-induced protein
    Species: Oryza sativa subsp. indica [TaxId:39946]
    Gene: SALT, ML, OsI_001780
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d5gvya_
  • Chain 'B':
    Compound: Salt stress-induced protein
    Species: Oryza sativa subsp. indica [TaxId:39946]
    Gene: SALT, ML, OsI_001780
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d5gvyb_
  • Heterogens: MAN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5gvyA (A:)
    mtlvkiglwggnggsaqdisvppkkllgvtiyssdairsiafnyigvdgqeyaigpwggg
    egtsteiklgssehikeisgthgpvydladivtylkivtsanntyeagvpngkefsiplq
    dsghvvgffgrsgtlidaigiyvhp
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5gvyB (B:)
    mtlvkiglwggnggsaqdisvppkkllgvtiyssdairsiafnyigvdgqeyaigpwggg
    egtsteiklgssehikeisgthgpvydladivtylkivtsanntyeagvpngkefsiplq
    dsghvvgffgrsgtlidaigiyvhp