PDB entry 5gvy

View 5gvy on RCSB PDB site
Description: Crystal structure of SALT protein from Oryza sativa
Class: sugar binding protein
Keywords: Salt tolerance, Rice, Mannose binding lectin, SUGAR BINDING PROTEIN
Deposited on 2016-09-07, released 2017-09-13
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-07-29, with a file datestamp of 2020-07-02.
Experiment type: XRAY
Resolution: 1.66 Å
R-factor: N/A
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Salt stress-induced protein
  Species: Oryza sativa subsp. indica [TaxId:39946]
  Gene: SALT, ML, OsI_001780
  Database cross-references and differences (RAF-indexed):
  • Uniprot A2WPN7 (0-144)
  Domains in SCOPe 2.08: d5gvya_
• Chain 'B':
  Compound: Salt stress-induced protein
  Species: Oryza sativa subsp. indica [TaxId:39946]
  Gene: SALT, ML, OsI_001780
  Database cross-references and differences (RAF-indexed):
  • Uniprot A2WPN7 (0-144)
  Domains in SCOPe 2.08: d5gvyb_
• Heterogens: MAN, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >5gvyA (A:)
  mtlvkiglwggnggsaqdisvppkkllgvtiyssdairsiafnyigvdgqeyaigpwggg
  egtsteiklgssehikeisgthgpvydladivtylkivtsanntyeagvpngkefsiplq
  dsghvvgffgrsgtlidaigiyvhp
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >5gvyB (B:)
  mtlvkiglwggnggsaqdisvppkkllgvtiyssdairsiafnyigvdgqeyaigpwggg
  egtsteiklgssehikeisgthgpvydladivtylkivtsanntyeagvpngkefsiplq
  dsghvvgffgrsgtlidaigiyvhp