PDB entry 5gvv

View 5gvv on RCSB PDB site
Description: crystal structure of the glycosyltransferase glye in streptococcus pneumoniae tigr4
Deposited on 2016-09-07, released 2017-03-01
The last revision was dated 2017-12-06, with a file datestamp of 2017-12-01.
Experiment type: XRAY
Resolution: 1.95 Å
R-factor: N/A
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Glycosyl transferase family 8
    Species: Streptococcus pneumoniae [TaxId:1313]
    Gene: gspA_4, ERS409372_01175, ERS515225_01083
    Database cross-references and differences (RAF-indexed):
  • Chain 'F':
    Compound: Glycosyl transferase family 8
    Species: Streptococcus pneumoniae [TaxId:1313]
    Gene: gspA_4, ERS409372_01175, ERS515225_01083
    Database cross-references and differences (RAF-indexed):
  • Heterogens: MN, UDP, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >5gvvA (A:)
    mrntkravvfagdyayirqietamkslcrhnshlkiyllnqdipqewfsqiriylqemgg
    dlidckligsqfqmnwsnklphinhmtfaryfipdfvtedkvlyldsdlivtgdltdlfe
    ldlgenylaaarscfgagvgfnagvllinnkkwgsetirqklidltekehenveegdqsi
    lnmlfkdqyssledqynfqigydygaatfkhqfifdipleplplilhyisqdkpwnqfsv
    grlrevwweyslmdwsvilnewfsksvkypsksqifklqcvnltnswcvekidylaeqlp
    evhfhivaytnmanellaltrfpnvtvypnslpmlleqiviasdlyldlnhdrkledaye
    fvlkykkpmiafdntcsenlseisyegiypssipkkmvaairsymr
    

    Sequence, based on observed residues (ATOM records):
    >5gvvA (A:)
    ntkravvfagdyayirqietamkslcrhnshlkiyllnqdipqewfsqiriylqemggdl
    idckligsqfhmtfaryfipdfvtedkvlyldsdlivtgdltdlfeldlgenylaaarsc
    fgagvgfnagvllinnkkwgsetirqklidltekehenveegdqsilnmlfkdqyssled
    qynfqigydygaatfkhqfifdipleplplilhyisqdkpwnqfsvgrlrevwweyslmd
    wsvilnewfsksvkypsksqifklqcvnltnswcvekidylaeqlpevhfhivaytnman
    ellaltrfpnvtvypnslpmlleqiviasdlyldlnhdrkledayefvlkykkpmiafdn
    tcsenlseisyegiypssipkkmvaairsymr
    

  • Chain 'F':
    Sequence, based on SEQRES records:
    >5gvvF (F:)
    mrntkravvfagdyayirqietamkslcrhnshlkiyllnqdipqewfsqiriylqemgg
    dlidckligsqfqmnwsnklphinhmtfaryfipdfvtedkvlyldsdlivtgdltdlfe
    ldlgenylaaarscfgagvgfnagvllinnkkwgsetirqklidltekehenveegdqsi
    lnmlfkdqyssledqynfqigydygaatfkhqfifdipleplplilhyisqdkpwnqfsv
    grlrevwweyslmdwsvilnewfsksvkypsksqifklqcvnltnswcvekidylaeqlp
    evhfhivaytnmanellaltrfpnvtvypnslpmlleqiviasdlyldlnhdrkledaye
    fvlkykkpmiafdntcsenlseisyegiypssipkkmvaairsymr
    

    Sequence, based on observed residues (ATOM records):
    >5gvvF (F:)
    kravvfagdyayirqietamkslcrhnshlkiyllnqdipqewfsqiriylqemggdlid
    ckligsqfmtfaryfipdfvtedkvlyldsdlivtgdltdlfeldlgenylaaarscfga
    gvgfnagvllinnkkwgsetirqklidltekehenveegdqsilnmlfkdqyssledqyn
    fqigydygaatfkhqfifdipleplplilhyisqdkpwnqfsvgrlrevwweyslmdwsv
    ilnewfsksvkypsksqifklqcvnltnswcvekidylaeqlpevhfhivaytnmanell
    altrfpnvtvypnslpmlleqiviasdlyldlnhdrkledayefvlkykkpmiafdntcs
    enlyegiypssipkkmvaairsymr