PDB entry 5gvs

View 5gvs on RCSB PDB site
Description: Crystal structure of the DDX41 DEAD domain in an apo open form
Class: hydrolase
Keywords: ATPase, DEAD box protein, HYDROLASE
Deposited on 2016-09-06, released 2016-10-19
The last revision prior to the SCOPe 2.06 freeze date was dated 2016-10-19, with a file datestamp of 2016-10-14.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: N/A
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Probable ATP-dependent RNA helicase DDX41
    Species: Homo sapiens [TaxId:9606]
    Gene: DDX41, ABS
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5gvsa_
  • Chain 'B':
    Compound: Probable ATP-dependent RNA helicase DDX41
    Species: Homo sapiens [TaxId:9606]
    Gene: DDX41, ABS
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5gvsb_
  • Chain 'C':
    Compound: Probable ATP-dependent RNA helicase DDX41
    Species: Homo sapiens [TaxId:9606]
    Gene: DDX41, ABS
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5gvsc_
  • Chain 'D':
    Compound: Probable ATP-dependent RNA helicase DDX41
    Species: Homo sapiens [TaxId:9606]
    Gene: DDX41, ABS
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5gvsd_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5gvsA (A:)
    ilvegdgipppiksfkemkfpaailrglkkkgihhptpiqiqgiptilsgrdmigiaftg
    sgktlvftlpvimfcleqekrlpfskregpygliicpsrelarqthgileyycrllqeds
    spllrcalciggmsvkeqmetirhgvhmmvatpgrlmdllqkkmvsldicrylaldeadr
    midmgfegdirtifsyfkgqrqtllfsatmpkkiqnfaksalvkpvtinvg
    

    Sequence, based on observed residues (ATOM records): (download)
    >5gvsA (A:)
    kemkfpaailrglkkkgihhptpiqiqgiptilsgrdmigiaftgsgktlvftlpvimfc
    leqekrlpfskregpygliicpsrelarqthgileyycrllqedsspllrcalciggmsv
    keqmetirhgvhmmvatpgrlmdllqkkmvsldicrylaldeadrmidmgfegdirtifs
    yfkgqrqtllfsatmpkkiqnfaksalvkpvtinvg
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5gvsB (B:)
    ilvegdgipppiksfkemkfpaailrglkkkgihhptpiqiqgiptilsgrdmigiaftg
    sgktlvftlpvimfcleqekrlpfskregpygliicpsrelarqthgileyycrllqeds
    spllrcalciggmsvkeqmetirhgvhmmvatpgrlmdllqkkmvsldicrylaldeadr
    midmgfegdirtifsyfkgqrqtllfsatmpkkiqnfaksalvkpvtinvg
    

    Sequence, based on observed residues (ATOM records): (download)
    >5gvsB (B:)
    emkfpaailrglkkkgihhptpiqiqgiptilsgrdmigiaftgsgktlvftlpvimfcl
    eqekrlpfskregpygliicpsrelarqthgileyycrllqedsspllrcalciggmsvk
    eqmetirhgvhmmvatpgrlmdllqkkmvsldicrylaldeadrmidmgfegdirtifsy
    fkgqrqtllfsatmpkkiqnfaksalvkpvtinvg
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5gvsC (C:)
    ilvegdgipppiksfkemkfpaailrglkkkgihhptpiqiqgiptilsgrdmigiaftg
    sgktlvftlpvimfcleqekrlpfskregpygliicpsrelarqthgileyycrllqeds
    spllrcalciggmsvkeqmetirhgvhmmvatpgrlmdllqkkmvsldicrylaldeadr
    midmgfegdirtifsyfkgqrqtllfsatmpkkiqnfaksalvkpvtinvg
    

    Sequence, based on observed residues (ATOM records): (download)
    >5gvsC (C:)
    ailrglkkkgiptilsgrdmigiaftgsgktlvftlpvimfcleqekrlpfskregpygl
    iicpsrelarqthgileyycrllqedsspllrcalciggmsvkeqmetirhgvhmmvatp
    grlmdllqkkmvsldicrylaldeadrmidmgfegdirtifsyfkgqrqtllfsatmpkk
    iqnfaksalvkpvtinvg
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >5gvsD (D:)
    ilvegdgipppiksfkemkfpaailrglkkkgihhptpiqiqgiptilsgrdmigiaftg
    sgktlvftlpvimfcleqekrlpfskregpygliicpsrelarqthgileyycrllqeds
    spllrcalciggmsvkeqmetirhgvhmmvatpgrlmdllqkkmvsldicrylaldeadr
    midmgfegdirtifsyfkgqrqtllfsatmpkkiqnfaksalvkpvtinvg
    

    Sequence, based on observed residues (ATOM records): (download)
    >5gvsD (D:)
    ailrglkkkiptilsgrdmigiaftgsgktlvftlpvimfcleqekrlpfskregpygli
    icpsrelarqthgileyycrllqedsspllrcalciggmsvkeqmetirhgvhmmvatpg
    rlmdllqkkmvsldicrylaldeadrmidmgfegdirtifsyfkgqrqtllfsatmpkki
    qnfaksalvkpvtinvg