PDB entry 5gvk

View 5gvk on RCSB PDB site
Description: Plasmodium vivax SHMT bound with PLP-glycine and GS256
Class: transferase/transferase inhibitor
Keywords: alpha and beta protein, methyltransferase activity, TRANSFERASE-TRANSFERASE INHIBITOR complex
Deposited on 2016-09-06, released 2017-07-12
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-07-12, with a file datestamp of 2017-07-07.
Experiment type: XRAY
Resolution: 2.24 Å
R-factor: N/A
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Serine hydroxymethyltransferase, putative
    Species: Plasmodium vivax (strain Salvador I) [TaxId:126793]
    Gene: PVX_100730
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5gvka_
  • Chain 'B':
    Compound: Serine hydroxymethyltransferase, putative
    Species: Plasmodium vivax (strain Salvador I) [TaxId:126793]
    Gene: PVX_100730
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5gvkb_
  • Chain 'C':
    Compound: Serine hydroxymethyltransferase, putative
    Species: Plasmodium vivax (strain Salvador I) [TaxId:126793]
    Gene: PVX_100730
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5gvkc_
  • Heterogens: PLG, G45, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5gvkA (A:)
    mfnnepleqidkelhdiladeekrqretinliasenltngavreclgnrvsnkysegypk
    kryyggndfidkieelcqkraleafnvsdeewgvnvqplsgsaanvqalyalvgvkgkim
    gmhlcsgghlthgffdekkkvsitsdmfesklykcnsqgyvdldavremalsfkpkviic
    gytsyprdidyqqfrqicdevnaylfadishissfvacnilnnpflhadvvtttthkilr
    gprsaliffnkkrnpgieqkinsavfpsfqggphnnkiaavacqlkevhspafkeytqqv
    llnskalakaliskqidlvtngtdnhlivvdlrkfsitgsklqetcnainvslnkntips
    dvdcvspsgvrigtpamttrgakekdmefiadvlaraikitvdlqeqygkklvdfkkglp
    gnaqlqqlkqevvtwagalpfp
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5gvkB (B:)
    mfnnepleqidkelhdiladeekrqretinliasenltngavreclgnrvsnkysegypk
    kryyggndfidkieelcqkraleafnvsdeewgvnvqplsgsaanvqalyalvgvkgkim
    gmhlcsgghlthgffdekkkvsitsdmfesklykcnsqgyvdldavremalsfkpkviic
    gytsyprdidyqqfrqicdevnaylfadishissfvacnilnnpflhadvvtttthkilr
    gprsaliffnkkrnpgieqkinsavfpsfqggphnnkiaavacqlkevhspafkeytqqv
    llnskalakaliskqidlvtngtdnhlivvdlrkfsitgsklqetcnainvslnkntips
    dvdcvspsgvrigtpamttrgakekdmefiadvlaraikitvdlqeqygkklvdfkkglp
    gnaqlqqlkqevvtwagalpfp
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5gvkC (C:)
    mfnnepleqidkelhdiladeekrqretinliasenltngavreclgnrvsnkysegypk
    kryyggndfidkieelcqkraleafnvsdeewgvnvqplsgsaanvqalyalvgvkgkim
    gmhlcsgghlthgffdekkkvsitsdmfesklykcnsqgyvdldavremalsfkpkviic
    gytsyprdidyqqfrqicdevnaylfadishissfvacnilnnpflhadvvtttthkilr
    gprsaliffnkkrnpgieqkinsavfpsfqggphnnkiaavacqlkevhspafkeytqqv
    llnskalakaliskqidlvtngtdnhlivvdlrkfsitgsklqetcnainvslnkntips
    dvdcvspsgvrigtpamttrgakekdmefiadvlaraikitvdlqeqygkklvdfkkglp
    gnaqlqqlkqevvtwagalpfp