PDB entry 5gvj

View 5gvj on RCSB PDB site
Description: structure of fabk (m276a) mutant from thermotoga maritima
Deposited on 2016-09-06, released 2017-04-26
The last revision was dated 2017-04-26, with a file datestamp of 2017-04-21.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: N/A
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Enoyl-[acyl-carrier-protein] reductase [FMN]
    Species: Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) [TaxId:243274]
    Gene: TM_0800, Tmari_0801
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9WZQ7 (1-End)
      • engineered mutation (275)
  • Chain 'B':
    Compound: Enoyl-[acyl-carrier-protein] reductase [FMN]
    Species: Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) [TaxId:243274]
    Gene: TM_0800, Tmari_0801
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9WZQ7
      • engineered mutation (275)
  • Heterogens: NA, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >5gvjA (A:)
    mtvrtrvtdlleiehpilmggmawagtptlaaavseagglgiigsgamkpddlrkaisel
    rqktdkpfgvniilvspwaddlvkvcieekvpvvtfgagnptkyirelkengtkvipvva
    sdslarmveragadaviaegmesgghigevttfvlvnkvsrsvnipviaaggiadgrgma
    aafalgaeavqmgtrfvasvesdvhpvykekivkasirdtvvtgaklghparvlrtpfar
    kiqemefenpmqaeemlvgslrravvegdlergsfavgqsaglideikpvkqiiedilke
    fketveklrgyiee
    

    Sequence, based on observed residues (ATOM records):
    >5gvjA (A:)
    tvrtrvtdlleiehpilmggmawagtptlaaavseagglgiigsgamkpddlrkaiselr
    qktdkpfgvniilvspwaddlvkvcieekvpvvtfgagnptkyirelkengtkvipvvas
    dslarmveragadaviaegmesgghigevttfvlvnkvsrsvnipviaaggiadgrgmaa
    afalgaeavqmgtrfvasvesdvhpvykekivkasirdtvvtghparvlrtpfarkiqlv
    gslrravvegdlergsfavgqsaglideikpvkqiiedilkefketveklrgyi
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >5gvjB (B:)
    mtvrtrvtdlleiehpilmggmawagtptlaaavseagglgiigsgamkpddlrkaisel
    rqktdkpfgvniilvspwaddlvkvcieekvpvvtfgagnptkyirelkengtkvipvva
    sdslarmveragadaviaegmesgghigevttfvlvnkvsrsvnipviaaggiadgrgma
    aafalgaeavqmgtrfvasvesdvhpvykekivkasirdtvvtgaklghparvlrtpfar
    kiqemefenpmqaeemlvgslrravvegdlergsfavgqsaglideikpvkqiiedilke
    fketveklrgyiee
    

    Sequence, based on observed residues (ATOM records):
    >5gvjB (B:)
    vrtrvtdlleiehpilmggmawagtptlaaavseagglgiigsgamkpddlrkaiselrq
    ktdkpfgvniilvspwaddlvkvcieekvpvvtfgagnptkyirelkengtkvipvvasd
    slarmveragadaviaegmesgghigevttfvlvnkvsrsvnipviaaggiadgrgmaaa
    falgaeavqmgtrfvasvesdvhpvykekivkasirdtvvtgahparvlrtpfarkiqee
    mlvgslrravvegdlergsfavgqsaglideikpvkqiiedilkefketveklrgyi