PDB entry 5gvd

View 5gvd on RCSB PDB site
Description: human tdrd3 duf1767-ob domains
Deposited on 2016-09-05, released 2017-06-14
The last revision was dated 2017-06-14, with a file datestamp of 2017-06-09.
Experiment type: XRAY
Resolution: 1.62 Å
R-factor: N/A
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Tudor domain-containing protein 3
    Species: Homo sapiens [TaxId:9606]
    Gene: Tdrd3
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9H7E2 (4-164)
      • expression tag (0-3)
  • Chain 'B':
    Compound: Tudor domain-containing protein 3
    Species: Homo sapiens [TaxId:9606]
    Gene: Tdrd3
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9H7E2 (4-164)
      • expression tag (0-3)
  • Heterogens: PO4, EDO, MG, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >5gvdA (A:)
    gpghmaqvagaalsqagwylsdegieactsspdkvnvndiilialntdlrtigkkflpsd
    insgkveklegpcvlqiqkirnvaapkdneesqaaprmlrlqmtdghisctavefsymsk
    islntppgtkvklsgivdikngflllndsnttvlggevehliekw
    

    Sequence, based on observed residues (ATOM records):
    >5gvdA (A:)
    gpghmaqvagaalsqagwylsdegieactsspdkvnvndiilialntdlrtigkkflpsd
    insgkveklegpcvlqiqkirnaprmlrlqmtdghisctavefsymskislntppgtkvk
    lsgivdikngflllndsnttvlggevehliekw
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >5gvdB (B:)
    gpghmaqvagaalsqagwylsdegieactsspdkvnvndiilialntdlrtigkkflpsd
    insgkveklegpcvlqiqkirnvaapkdneesqaaprmlrlqmtdghisctavefsymsk
    islntppgtkvklsgivdikngflllndsnttvlggevehliekw
    

    Sequence, based on observed residues (ATOM records):
    >5gvdB (B:)
    gpghmaqvagaalsqagwylsdegieactsspdkvnvndiilialntdlrtigkkflpsd
    insgkveklegpcvlqiqkirnvarmlrlqmtdghisctavefsymskislntppgtkvk
    lsgivdikngflllndsnttvlggevehliekw