PDB entry 5gv4

View 5gv4 on RCSB PDB site
Description: y74cox mutant of plasmodium falciparum triosephosphate isomerase
Class: isomerase
Keywords: tim barrel, beta-alpha barrels, isomerase, glycolysis, covalent dimer
Deposited on 2016-09-01, released 2017-09-06
The last revision prior to the SCOPe 2.06 freeze date was dated 2017-09-06, with a file datestamp of 2017-09-01.
Experiment type: XRAY
Resolution: 2.09 Å
R-factor: N/A
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: triosephosphate isomerase
    Species: Plasmodium falciparum [TaxId:5833]
    Gene: tpi
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q07412 (Start-247)
      • engineered mutation (73)
      • engineered mutation (162)
    Domains in SCOPe 2.06: d5gv4a_
  • Heterogens: PGA, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5gv4A (A:)
    markyfvaanwkcngtlesiksltnsfnnldfdpskldvvvfpvsvhydhtrkllqskfs
    tgiqnvskfgngsctgevsaeiakdlnieyviighferrkyfhetdedvreklqaslknn
    lkavvcfgesleqreqnktievitkqvkafvdlidnfdnvilvyeplwaigtgktatpeq
    aqlvhkeirkivkdtcgekqanqirilyggsvntencssliqqedidgflvgnaslkesf
    vdiiksam
    

    Sequence, based on observed residues (ATOM records): (download)
    >5gv4A (A:)
    arkyfvaanwkcngtlesiksltnsfnnldfdpskldvvvfpvsvhydhtrkllqskfst
    giqnvskfngsctgevsaeiakdlnieyviighferrkyfhetdedvreklqaslknnlk
    avvcfgesleqreqnktievitkqvkafvdlidnfdnvilvyeplwaigtgktatpeqaq
    lvhkeirkivkdtcgekqanqirilyggsvntencssliqqedidgflvgnaslkesfvd
    iiksam