PDB entry 5gv0

View 5gv0 on RCSB PDB site
Description: Crystal structure of the membrane-proximal domain of mouse lysosome-associated membrane protein 1 (LAMP-1)
Class: membrane protein
Keywords: membrane protein
Deposited on 2016-09-01, released 2016-10-12
The last revision prior to the SCOPe 2.07 freeze date was dated 2016-10-19, with a file datestamp of 2016-10-14.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: N/A
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Lysosome-associated membrane glycoprotein 1
    Species: Mus musculus [TaxId:10090]
    Gene: Lamp1, Lamp-1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P11438 (1-End)
      • expression tag (0)
    Domains in SCOPe 2.07: d5gv0a1, d5gv0a2
  • Heterogens: SO4, NAG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5gv0A (A:)
    dptvskynvtgnngtcllasmalqlnitylkkdnktvtrafnispndtssgscginlvtl
    kvenknralelqfgmnassslfflqgvrlnmtlpdalvptfsisnhslkalqatvgnsyk
    cnteehifvskmlslnvfsvqvqafkvdsdrfgsveecvqdgnngssl
    

    Sequence, based on observed residues (ATOM records): (download)
    >5gv0A (A:)
    dptvskynvtgnngtcllasmalqlnitylkkdnktvtrafnispndtssgscginlvtl
    kvenknralelqfgmnassslfflqgvrlnmtlpdalvptfsisnhslkalqatvgnsyk
    cnteehifvskmlslnvfsvqvqafkvdsdrfgsveecvqdg