PDB entry 5gui

View 5gui on RCSB PDB site
Description: crystal structure of the n-terminal domain of caseinolytic protease associated chaperone clpc1 from arabidopsis thaliana
Deposited on 2016-08-29, released 2017-03-22
The last revision was dated 2020-01-01, with a file datestamp of 2019-12-27.
Experiment type: XRAY
Resolution: 1.2 Å
R-factor: N/A
AEROSPACI score: 0.66 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Chaperone protein ClpC1, chloroplastic
    Species: Arabidopsis thaliana [TaxId:3702]
    Gene: CLPC1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9FI56 (0-144)
      • expression tag (145-147)
  • Heterogens: PO4, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >5guiA (A:)
    mferftekaikvimlaqeearrlghnfvgteqillgligegtgiaakvlksmginlkdar
    vevekiigrgsgfvaveipftprakrvlelsleearqlghnyigsehlllgllregegva
    arvlenlgadpsnirtqvirmvgenlehhhhhh
    

    Sequence, based on observed residues (ATOM records):
    >5guiA (A:)
    mferftekaikvimlaqeearrlghnfvgteqillgligegtgiaakvlksmginlkdar
    vevekiigrgsgfvaveipftprakrvlelsleearqlghnyigsehlllgllregegva
    arvlenlgadpsnirtqvirmvgenleh