PDB entry 5guh

View 5guh on RCSB PDB site
Description: crystal structure of silkworm piwi-clade argonaute siwi bound to pirna
Deposited on 2016-08-29, released 2016-10-19
The last revision was dated 2017-09-27, with a file datestamp of 2017-09-22.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: N/A
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: piwi
    Species: Bombyx mori [TaxId:7091]
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: RNA (28-mer)
    Species: Bombyx mori [TaxId:7091]
  • Heterogens: MG, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >5guhA (A:)
    mseprgrgrargragrggdgggpaprrpgeqagpsqqsmppgprpqppsgwgpqssvppv
    ragvptptaqagrashrvtptthehpgdidvqqrmqklelgphssgggdassvvgrgsrr
    gggrvlpetisilrtrpeavtskkgtsgtpldllanyftvettpkwglyqyhvdispeed
    stgvrkalmrvhsktlggylfdgtvlytvnrlhpdpmelysdrktdnermrilikltcev
    spgdyhyiqifniiirkcfnllklqlmgrdyfdpeakidipefklqiwpgykttinqyed
    rlllvteiahkvlrmdtvlqmlseyaatkgnnykkifledvvgkivmtdynkrtyrvddv
    awnvspkstfkmrdenityieyyykkynlriqdpgqpllisrskpreiraglpeliylvp
    elcrqtglsdemranfklmrsldvhtkigpdkrieklnnfnrrftstpevveelatwslk
    lskelvkikgrqlppeniiqannvkypagdttegwtrdmrskhllaiaqlnswvvitper
    qrrdtesfidliiktgggvgfrmrspdlvvirhdgpieyanmceeviarknpalilcvla
    rnyadryeaikkkctvdravptqvvcarnmssksamsiatkvaiqincklggspwtvdip
    lpslmvvgydvchdtrskeksfgafvatldkqmtqyysivnahtsgeelsshmgfniasa
    vkkfrekngtyparifiyrdgvgdgqipyvhshevaeikkklaeiyagveiklafiivsk
    rintrifvqrgrsgenprpgtviddvvtlperydfylvsqnvregtiaptsynviedttg
    lnpdriqrltyklthlyfncssqvrvpsvcqyahklaflaanslhnqphyslnetlyfl
    

    Sequence, based on observed residues (ATOM records):
    >5guhA (A:)
    isilrtrpeavtskkgtsgtpldllanyftvettpkwglyqyhvdispeedstgvrkalm
    rvhsktlggylfdgtvlytvnrlhpdpmelysdrktdnermrilikltcevspgdyhyiq
    ifniiirkcfnllklqlmgrdyfdpeakidipefklqiwpgykttinqyedrlllvteia
    hkvlrmdtvlqmlseyaatkkifledvvgkivmtdynkrtyrvddvanvspkstfkmrde
    nityieyyykkynlriqdpgqpllisrskpreiraglpeliylvpelcrqtglsdemran
    fklmrsldvhtkigpdkrieklnnfnrrftstpevveelatwslklskelvkikgrqlpp
    eniiqannvkypagdttegwtrdmrskhllaiaqlnswvvitperqrrdtesfidliikt
    gggvgfrmrspdlvvirhdgpieyanmceeviarknpalilcvlarnyadryeaikkkct
    vdravptqvvcarnmssksamsiatkvaiqincklggspwtvdiplpslmvvgydvchdt
    rskeksfgafvatldkqmtqyysivnahlsshmgfniasavkkfrekngtyparifiyrd
    gvgdgqipyvhshevaeikkklaeiyagveiklafiivskrintrifvqrgrsgenprpg
    tviddvvtlperydfylvsqnvregtiaptsynviedttglnpdriqrltyklthlyfnc
    ssqvrvpsvcqyahklaflaanslhnqphyslnetlyfl
    

  • Chain 'B':
    No sequence available.