PDB entry 5gue

View 5gue on RCSB PDB site
Description: crystal structure of cotb2 (ggspp/mg2+-bound form) from streptomyces melanosporofaciens
Deposited on 2016-08-28, released 2017-06-07
The last revision was dated 2017-07-05, with a file datestamp of 2017-06-30.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: N/A
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cyclooctat-9-en-7-ol synthase
    Species: Streptomyces melanosporofaciens [TaxId:67327]
    Gene: CotB2
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: Cyclooctat-9-en-7-ol synthase
    Species: Streptomyces melanosporofaciens [TaxId:67327]
    Gene: CotB2
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: Cyclooctat-9-en-7-ol synthase
    Species: Streptomyces melanosporofaciens [TaxId:67327]
    Gene: CotB2
    Database cross-references and differences (RAF-indexed):
  • Chain 'D':
    Compound: Cyclooctat-9-en-7-ol synthase
    Species: Streptomyces melanosporofaciens [TaxId:67327]
    Gene: CotB2
    Database cross-references and differences (RAF-indexed):
  • Heterogens: GGS, MG, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >5gueA (A:)
    mkhhhhhhhhgglvprgshggsefmttglstagaqdigrssvrpyleectrrfqemfdrh
    vvtrptkveltdaelreviddcnaavaplgktvsderwisyvgvvlwsqsprhikdmeaf
    kavcvlncvtfvwddmdpalhdfglflpqlrkicekyygpedaevayeaarafvtsdhmf
    rdspikaalcttspeqyfrfrvtdigvdfwmkmsypiyrhpeftehaktslaarmttrgl
    tivndfysydrevslgqitncfrlcdvsdetafkeffqarlddmiediecikafdqltqd
    vfldliygnfvwttsnkryktavndvnsriq
    

    Sequence, based on observed residues (ATOM records):
    >5gueA (A:)
    digrssvrpyleectrrfqemfdrhvvtrptkveltdaelreviddcnaavaplgktvsd
    erwisyvgvvlwsqsprhikdmeafkavcvlncvtfvwddmdpalhdfglflpqlrkice
    kyygpedaevayeaarafvtsdhmfrdspikaalcttspeqyfrfrvtdigvdfwmkmsy
    piyrhpeftehaktslaarmttrgltivndfysydrevslgqitncfrlcdvsdetafke
    ffqarlddmiediecikafdqltqdvfldliygnfvwttsnkryk
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >5gueB (B:)
    mkhhhhhhhhgglvprgshggsefmttglstagaqdigrssvrpyleectrrfqemfdrh
    vvtrptkveltdaelreviddcnaavaplgktvsderwisyvgvvlwsqsprhikdmeaf
    kavcvlncvtfvwddmdpalhdfglflpqlrkicekyygpedaevayeaarafvtsdhmf
    rdspikaalcttspeqyfrfrvtdigvdfwmkmsypiyrhpeftehaktslaarmttrgl
    tivndfysydrevslgqitncfrlcdvsdetafkeffqarlddmiediecikafdqltqd
    vfldliygnfvwttsnkryktavndvnsriq
    

    Sequence, based on observed residues (ATOM records):
    >5gueB (B:)
    digrssvrpyleectrrfqemfdrhvvtrptkveltdaelreviddcnaavaplgktvsd
    erwisyvgvvlwsqsprhikdmeafkavcvlncvtfvwddmdpalhdfglflpqlrkice
    kyygpedaevayeaarafvtsdhmfrdspikaalcttspeqyfrfrvtdigvdfwmkmsy
    piyrhpeftehaktslaarmttrgltivndfysydrevslgqitncfrlcdvsdetafke
    ffqarlddmiediecikafdqltqdvfldliygnfvwttsnkryk
    

  • Chain 'C':
    Sequence, based on SEQRES records:
    >5gueC (C:)
    mkhhhhhhhhgglvprgshggsefmttglstagaqdigrssvrpyleectrrfqemfdrh
    vvtrptkveltdaelreviddcnaavaplgktvsderwisyvgvvlwsqsprhikdmeaf
    kavcvlncvtfvwddmdpalhdfglflpqlrkicekyygpedaevayeaarafvtsdhmf
    rdspikaalcttspeqyfrfrvtdigvdfwmkmsypiyrhpeftehaktslaarmttrgl
    tivndfysydrevslgqitncfrlcdvsdetafkeffqarlddmiediecikafdqltqd
    vfldliygnfvwttsnkryktavndvnsriq
    

    Sequence, based on observed residues (ATOM records):
    >5gueC (C:)
    digrssvrpyleectrrfqemfdrhvvtrptkveltdaelreviddcnaavaplgktvsd
    erwisyvgvvlwsqsprhikdmeafkavcvlncvtfvwddmdpalhdfglflpqlrkice
    kyygpedaevayeaarafvtsdhmfrdspikaalcttspeqyfrfrvtdigvdfwmkmsy
    piyrhpeftehaktslaarmttrgltivndfysydrevslgqitncfrlcdvsdetafke
    ffqarlddmiediecikafdqltqdvfldliygnfvwttsnkryk
    

  • Chain 'D':
    Sequence, based on SEQRES records:
    >5gueD (D:)
    mkhhhhhhhhgglvprgshggsefmttglstagaqdigrssvrpyleectrrfqemfdrh
    vvtrptkveltdaelreviddcnaavaplgktvsderwisyvgvvlwsqsprhikdmeaf
    kavcvlncvtfvwddmdpalhdfglflpqlrkicekyygpedaevayeaarafvtsdhmf
    rdspikaalcttspeqyfrfrvtdigvdfwmkmsypiyrhpeftehaktslaarmttrgl
    tivndfysydrevslgqitncfrlcdvsdetafkeffqarlddmiediecikafdqltqd
    vfldliygnfvwttsnkryktavndvnsriq
    

    Sequence, based on observed residues (ATOM records):
    >5gueD (D:)
    digrssvrpyleectrrfqemfdrhvvtrptkveltdaelreviddcnaavaplgktvsd
    erwisyvgvvlwsqsprhikdmeafkavcvlncvtfvwddmdpalhdfglflpqlrkice
    kyygpedaevayeaarafvtsdhmfrdspikaalcttspeqyfrfrvtdigvdfwmkmsy
    piyrhpeftehaktslaarmttrgltivndfysydrevslgqitncfrlcdvsdetafke
    ffqarlddmiediecikafdqltqdvfldliygnfvwttsnkryk