PDB entry 5gud

View 5gud on RCSB PDB site
Description: Glutamate dehydrogenase from Corynebacterium glutamicum (alpha-iminoglutarate/NADP+ complex)
Class: oxidoreductase
Keywords: rossmann fold, glutamate dehydrogenase, oxidoreductase
Deposited on 2016-08-28, released 2017-06-07
The last revision prior to the SCOPe 2.06 freeze date was dated 2017-06-07, with a file datestamp of 2017-06-02.
Experiment type: XRAY
Resolution: 1.68 Å
R-factor: N/A
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: glutamate dehydrogenase
    Species: Corynebacterium glutamicum [TaxId:1718]
    Gene: APT58_10030
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5guda1, d5guda2
  • Chain 'B':
    Compound: glutamate dehydrogenase
    Species: Corynebacterium glutamicum [TaxId:1718]
    Gene: APT58_10030
    Database cross-references and differences (RAF-indexed):
    • Uniprot A0A0U4QBJ6 (Start-470)
      • conflict (321-322)
    Domains in SCOPe 2.06: d5gudb1, d5gudb2
  • Chain 'C':
    Compound: glutamate dehydrogenase
    Species: Corynebacterium glutamicum [TaxId:1718]
    Gene: APT58_10030
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5gudc1, d5gudc2
  • Chain 'D':
    Compound: glutamate dehydrogenase
    Species: Corynebacterium glutamicum [TaxId:1718]
    Gene: APT58_10030
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5gudd1, d5gudd2
  • Chain 'E':
    Compound: glutamate dehydrogenase
    Species: Corynebacterium glutamicum [TaxId:1718]
    Gene: APT58_10030
    Database cross-references and differences (RAF-indexed):
    • Uniprot A0A0U4QBJ6 (24-470)
      • expression tag (8-16)
      • expression tag (20-23)
      • conflict (321-322)
  • Chain 'F':
    Compound: glutamate dehydrogenase
    Species: Corynebacterium glutamicum [TaxId:1718]
    Gene: APT58_10030
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5gudf1, d5gudf2
  • Heterogens: 2IT, NDP, K, CIT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5gudA (A:)
    mkhhhhhhhhgglvprgshggsefmtvdeqvsnyydmllkrnagepefhqavaevleslk
    ivlekdphyadygliqrlceperqlifrvpwvddqgqvhvnrgfrvqfnsalgpykgglr
    fhpsvnlgivkflgfeqifknsltglpigggkggsdfdpkgksdleimrfcqsfmtelhr
    higeyrdvpagdigvggreigylfghyrrmanqhesgvltgkgltwggslvrteatgygc
    vyfvsemikakgesisgqkiivsgsgnvatyaiekaqelgatvigfsdssgwvhtpngvd
    vaklreikevrrarvsvyadeiegatyhtdgsiwdlkcdialpcatqnelngenaktlad
    ngcrfvaeganmpstpeavevfrerdirfgpgkaanaggvatsalemqqnasrdswsfey
    tderlqvimknifktcaetaaeyghendyvvganiagfkkvadamlaqgvi
    

    Sequence, based on observed residues (ATOM records): (download)
    >5gudA (A:)
    mtvdeqvsnyydmllkrnagepefhqavaevleslkivlekdphyadygliqrlceperq
    lifrvpwvddqgqvhvnrgfrvqfnsalgpykgglrfhpsvnlgivkflgfeqifknslt
    glpigggkggsdfdpkgksdleimrfcqsfmtelhrhigeyrdvpagdigvggreigylf
    ghyrrmanqhesgvltgkgltwggslvrteatgygcvyfvsemikakgesisgqkiivsg
    sgnvatyaiekaqelgatvigfsdssgwvhtpngvdvaklreikevrrarvsvyadeieg
    atyhtdgsiwdlkcdialpcatqnelngenaktladngcrfvaeganmpstpeavevfre
    rdirfgpgkaanaggvatsalemqqnasrdswsfeytderlqvimknifktcaetaaeyg
    hendyvvganiagfkkvadamlaqgvi
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5gudB (B:)
    mkhhhhhhhhgglvprgshggsefmtvdeqvsnyydmllkrnagepefhqavaevleslk
    ivlekdphyadygliqrlceperqlifrvpwvddqgqvhvnrgfrvqfnsalgpykgglr
    fhpsvnlgivkflgfeqifknsltglpigggkggsdfdpkgksdleimrfcqsfmtelhr
    higeyrdvpagdigvggreigylfghyrrmanqhesgvltgkgltwggslvrteatgygc
    vyfvsemikakgesisgqkiivsgsgnvatyaiekaqelgatvigfsdssgwvhtpngvd
    vaklreikevrrarvsvyadeiegatyhtdgsiwdlkcdialpcatqnelngenaktlad
    ngcrfvaeganmpstpeavevfrerdirfgpgkaanaggvatsalemqqnasrdswsfey
    tderlqvimknifktcaetaaeyghendyvvganiagfkkvadamlaqgvi
    

    Sequence, based on observed residues (ATOM records): (download)
    >5gudB (B:)
    tvdeqvsnyydmllkrnagepefhqavaevleslkivlekdphyadygliqrlceperql
    ifrvpwvddqgqvhvnrgfrvqfnsalgpykgglrfhpsvnlgivkflgfeqifknsltg
    lpigggkggsdfdpkgksdleimrfcqsfmtelhrhigeyrdvpagdigvggreigylfg
    hyrrmanqhesgvltgkgltwggslvrteatgygcvyfvsemikakgesisgqkiivsgs
    gnvatyaiekaqelgatvigfsdssgwvhtpngvdvaklreikevrrarvsvyadeiega
    tyhtdgsiwdlkcdialpcatqnelngenaktladngcrfvaeganmpstpeavevfrer
    dirfgpgkaanaggvatsalemqqnasrdswsfeytderlqvimknifktcaetaaeygh
    endyvvganiagfkkvadamlaqgvi
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5gudC (C:)
    mkhhhhhhhhgglvprgshggsefmtvdeqvsnyydmllkrnagepefhqavaevleslk
    ivlekdphyadygliqrlceperqlifrvpwvddqgqvhvnrgfrvqfnsalgpykgglr
    fhpsvnlgivkflgfeqifknsltglpigggkggsdfdpkgksdleimrfcqsfmtelhr
    higeyrdvpagdigvggreigylfghyrrmanqhesgvltgkgltwggslvrteatgygc
    vyfvsemikakgesisgqkiivsgsgnvatyaiekaqelgatvigfsdssgwvhtpngvd
    vaklreikevrrarvsvyadeiegatyhtdgsiwdlkcdialpcatqnelngenaktlad
    ngcrfvaeganmpstpeavevfrerdirfgpgkaanaggvatsalemqqnasrdswsfey
    tderlqvimknifktcaetaaeyghendyvvganiagfkkvadamlaqgvi
    

    Sequence, based on observed residues (ATOM records): (download)
    >5gudC (C:)
    mtvdeqvsnyydmllkrnagepefhqavaevleslkivlekdphyadygliqrlceperq
    lifrvpwvddqgqvhvnrgfrvqfnsalgpykgglrfhpsvnlgivkflgfeqifknslt
    glpigggkggsdfdpkgksdleimrfcqsfmtelhrhigeyrdvpagdigvggreigylf
    ghyrrmanqhesgvltgkgltwggslvrteatgygcvyfvsemikakgesisgqkiivsg
    sgnvatyaiekaqelgatvigfsdssgwvhtpngvdvaklreikevrrarvsvyadeieg
    atyhtdgsiwdlkcdialpcatqnelngenaktladngcrfvaeganmpstpeavevfre
    rdirfgpgkaanaggvatsalemqqnasrdswsfeytderlqvimknifktcaetaaeyg
    hendyvvganiagfkkvadamlaqgvi
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >5gudD (D:)
    mkhhhhhhhhgglvprgshggsefmtvdeqvsnyydmllkrnagepefhqavaevleslk
    ivlekdphyadygliqrlceperqlifrvpwvddqgqvhvnrgfrvqfnsalgpykgglr
    fhpsvnlgivkflgfeqifknsltglpigggkggsdfdpkgksdleimrfcqsfmtelhr
    higeyrdvpagdigvggreigylfghyrrmanqhesgvltgkgltwggslvrteatgygc
    vyfvsemikakgesisgqkiivsgsgnvatyaiekaqelgatvigfsdssgwvhtpngvd
    vaklreikevrrarvsvyadeiegatyhtdgsiwdlkcdialpcatqnelngenaktlad
    ngcrfvaeganmpstpeavevfrerdirfgpgkaanaggvatsalemqqnasrdswsfey
    tderlqvimknifktcaetaaeyghendyvvganiagfkkvadamlaqgvi
    

    Sequence, based on observed residues (ATOM records): (download)
    >5gudD (D:)
    mtvdeqvsnyydmllkrnagepefhqavaevleslkivlekdphyadygliqrlceperq
    lifrvpwvddqgqvhvnrgfrvqfnsalgpykgglrfhpsvnlgivkflgfeqifknslt
    glpigggkggsdfdpkgksdleimrfcqsfmtelhrhigeyrdvpagdigvggreigylf
    ghyrrmanqhesgvltgkgltwggslvrteatgygcvyfvsemikakgesisgqkiivsg
    sgnvatyaiekaqelgatvigfsdssgwvhtpngvdvaklreikevrrarvsvyadeieg
    atyhtdgsiwdlkcdialpcatqnelngenaktladngcrfvaeganmpstpeavevfre
    rdirfgpgkaanaggvatsalemqqnasrdswsfeytderlqvimknifktcaetaaeyg
    hendyvvganiagfkkvadamlaqgvi
    

  • Chain 'E':
    No sequence available.

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >5gudF (F:)
    mkhhhhhhhhgglvprgshggsefmtvdeqvsnyydmllkrnagepefhqavaevleslk
    ivlekdphyadygliqrlceperqlifrvpwvddqgqvhvnrgfrvqfnsalgpykgglr
    fhpsvnlgivkflgfeqifknsltglpigggkggsdfdpkgksdleimrfcqsfmtelhr
    higeyrdvpagdigvggreigylfghyrrmanqhesgvltgkgltwggslvrteatgygc
    vyfvsemikakgesisgqkiivsgsgnvatyaiekaqelgatvigfsdssgwvhtpngvd
    vaklreikevrrarvsvyadeiegatyhtdgsiwdlkcdialpcatqnelngenaktlad
    ngcrfvaeganmpstpeavevfrerdirfgpgkaanaggvatsalemqqnasrdswsfey
    tderlqvimknifktcaetaaeyghendyvvganiagfkkvadamlaqgvi
    

    Sequence, based on observed residues (ATOM records): (download)
    >5gudF (F:)
    mtvdeqvsnyydmllkrnagepefhqavaevleslkivlekdphyadygliqrlceperq
    lifrvpwvddqgqvhvnrgfrvqfnsalgpykgglrfhpsvnlgivkflgfeqifknslt
    glpigggkggsdfdpkgksdleimrfcqsfmtelhrhigeyrdvpagdigvggreigylf
    ghyrrmanqhesgvltgkgltwggslvrteatgygcvyfvsemikakgesisgqkiivsg
    sgnvatyaiekaqelgatvigfsdssgwvhtpngvdvaklreikevrrarvsvyadeieg
    atyhtdgsiwdlkcdialpcatqnelngenaktladngcrfvaeganmpstpeavevfre
    rdirfgpgkaanaggvatsalemqqnasrdswsfeytderlqvimknifktcaetaaeyg
    hendyvvganiagfkkvadamlaqgvi