PDB entry 5gu4

View 5gu4 on RCSB PDB site
Description: rrna n-glycosylase rta
Deposited on 2016-08-24, released 2016-11-02
The last revision was dated 2016-11-02, with a file datestamp of 2016-10-28.
Experiment type: XRAY
Resolution: 1.55 Å
R-factor: N/A
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ricin
    Species: Ricinus communis [TaxId:3988]
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: ricin
    Species: Ricinus communis [TaxId:3988]
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: gly-phe-gly-leu-phe-asp
    Species: HOMO SAPIENS, synthetic [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 5GU4 (Start-8)
  • Chain 'D':
    Compound: gly-phe-gly-leu-phe-asp
    Species: HOMO SAPIENS, synthetic [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 5GU4 (Start-8)
  • Heterogens: GOL, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >5gu4A (A:)
    mgsshhhhhhssglvprgshmasmtggqqmgrgsifpkqypiinfttagatvqsytnfir
    avrgrlttgadvrheipvlpnrvglpinqrfilvelsnhaelsvtlaldvtnayvvgyra
    gnsayffhpdnqedaeaithlftdvqnrytfafggnydrleqlagnlrenielgngplee
    aisalyyystggtqlptlarsfiiciqmiseaarfqyiegemrtrirynrrsapdpsvit
    lenswgrlstaiqesnqgafaspiqlqrrngskfsvydvsilipiialmvyrcapppssq
    f
    

    Sequence, based on observed residues (ATOM records):
    >5gu4A (A:)
    ypiinfttagatvqsytnfiravrgrlttgadvrheipvlpnrvglpinqrfilvelsnh
    aelsvtlaldvtnayvvgyragnsayffhpdnqedaeaithlftdvqnrytfafggnydr
    leqlagnlrenielgngpleeaisalyyystggtqlptlarsfiiciqmiseaarfqyie
    gemrtrirynrrsapdpsvitlenswgrlstaiqesnqgafaspiqlqrrngskfsvydv
    silipiialmvyrca
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >5gu4B (B:)
    mgsshhhhhhssglvprgshmasmtggqqmgrgsifpkqypiinfttagatvqsytnfir
    avrgrlttgadvrheipvlpnrvglpinqrfilvelsnhaelsvtlaldvtnayvvgyra
    gnsayffhpdnqedaeaithlftdvqnrytfafggnydrleqlagnlrenielgngplee
    aisalyyystggtqlptlarsfiiciqmiseaarfqyiegemrtrirynrrsapdpsvit
    lenswgrlstaiqesnqgafaspiqlqrrngskfsvydvsilipiialmvyrcapppssq
    f
    

    Sequence, based on observed residues (ATOM records):
    >5gu4B (B:)
    ypiinfttagatvqsytnfiravrgrlttgadvrheipvlpnrvglpinqrfilvelsnh
    aelsvtlaldvtnayvvgyragnsayffhpdnqedaeaithlftdvqnrytfafggnydr
    leqlagnlrenielgngpleeaisalyyystggtqlptlarsfiiciqmiseaarfqyie
    gemrtrirynrrsapdpsvitlenswgrlstaiqesnqgafaspiqlqrrngskfsvydv
    silipiialmvyrca
    

  • Chain 'C':
    Sequence, based on SEQRES records:
    >5gu4C (C:)
    ddmgfglfd
    

    Sequence, based on observed residues (ATOM records):
    >5gu4C (C:)
    gfglfd
    

  • Chain 'D':
    Sequence, based on SEQRES records:
    >5gu4D (D:)
    ddmgfglfd
    

    Sequence, based on observed residues (ATOM records):
    >5gu4D (D:)
    gfglfd