PDB entry 5gu0

View 5gu0 on RCSB PDB site
Description: Crystal structure of Au.CL-apo-E45C/R52C-rHLFr
Class: metal binding protein
Keywords: iron storage, metal binding protein
Deposited on 2016-08-24, released 2017-03-29
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-03-29, with a file datestamp of 2017-03-24.
Experiment type: XRAY
Resolution: 1.95 Å
R-factor: N/A
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'X':
    Compound: ferritin light chain
    Species: Equus caballus [TaxId:9796]
    Gene: FTL
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02791
      • engineered mutation (44)
      • engineered mutation (51)
    Domains in SCOPe 2.07: d5gu0x_
  • Heterogens: AU, CD, SO4, EDO, HOH

PDB Chain Sequences:

  • Chain 'X':
    Sequence, based on SEQRES records: (download)
    >5gu0X (X:)
    ssqirqnysteveaavnrlvnlylrasytylslgfyfdrddvalcgvchffcelaeekre
    gaerllkmqnqrggralfqdlqkpsqdewgttldamkaaivlekslnqalldlhalgsaq
    adphlcdfleshfldeevklikkmgdhltniqrlvgsqaglgeylferltlkhd
    

    Sequence, based on observed residues (ATOM records): (download)
    >5gu0X (X:)
    qirqnysteveaavnrlvnlylrasytylslgfyfdrddvalcgvchffcelaeekrega
    erllkmqnqrggralfqdlqkpsqdewgttldamkaaivlekslnqalldlhalgsaqad
    phlcdfleshfldeevklikkmgdhltniqrlvgsqaglgeylferltlk