PDB entry 5gty

View 5gty on RCSB PDB site
Description: Crystal structure of EGFR 696-1022 T790M in complex with LXX-6-26
Class: transferase
Keywords: EGFR, T790M, LXX-6-26, inhibitor, TRANSFERASE
Deposited on 2016-08-23, released 2017-09-06
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-29, with a file datestamp of 2017-11-24.
Experiment type: XRAY
Resolution: 3.14 Å
R-factor: N/A
AEROSPACI score: 0.11 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Epidermal growth factor receptor
    Species: Homo sapiens [TaxId:9606]
    Gene: EGFR, ERBB, ERBB1, HER1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00533
      • engineered mutation (98)
    Domains in SCOPe 2.07: d5gtya_
  • Chain 'B':
    Compound: Epidermal growth factor receptor
    Species: Homo sapiens [TaxId:9606]
    Gene: EGFR, ERBB, ERBB1, HER1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00533
      • engineered mutation (98)
    Domains in SCOPe 2.07: d5gtyb_
  • Chain 'C':
    Compound: Epidermal growth factor receptor
    Species: Homo sapiens [TaxId:9606]
    Gene: EGFR, ERBB, ERBB1, HER1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00533
      • engineered mutation (98)
    Domains in SCOPe 2.07: d5gtyc_
  • Chain 'D':
    Compound: Epidermal growth factor receptor
    Species: Homo sapiens [TaxId:9606]
    Gene: EGFR, ERBB, ERBB1, HER1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00533
      • engineered mutation (98)
    Domains in SCOPe 2.07: d5gtyd_
  • Chain 'E':
    Compound: Epidermal growth factor receptor
    Species: Homo sapiens [TaxId:9606]
    Gene: EGFR, ERBB, ERBB1, HER1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00533
      • engineered mutation (98)
    Domains in SCOPe 2.07: d5gtye_
  • Chain 'F':
    Compound: Epidermal growth factor receptor
    Species: Homo sapiens [TaxId:9606]
    Gene: EGFR, ERBB, ERBB1, HER1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00533
      • engineered mutation (98)
    Domains in SCOPe 2.07: d5gtyf_
  • Chain 'G':
    Compound: Epidermal growth factor receptor
    Species: Homo sapiens [TaxId:9606]
    Gene: EGFR, ERBB, ERBB1, HER1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00533
      • engineered mutation (98)
    Domains in SCOPe 2.07: d5gtyg_
  • Chain 'H':
    Compound: Epidermal growth factor receptor
    Species: Homo sapiens [TaxId:9606]
    Gene: EGFR, ERBB, ERBB1, HER1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00533
      • engineered mutation (98)
    Domains in SCOPe 2.07: d5gtyh_
  • Heterogens: 816, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5gtyA (A:)
    gamggeapnqallrilketefkkikvlgsgafgtvykglwipegekvkipvaikelreat
    spkankeildeayvmasvdnphvcrllgicltstvqlimqlmpfgclldyvrehkdnigs
    qyllnwcvqiakgmnyledrrlvhrdlaarnvlvktpqhvkitdfglakllgaeekeyha
    eggkvpikwmalesilhriythqsdvwsygvtvwelmtfgskpydgipaseissilekge
    rlpqppictidvymimvkcwmidadsrpkfreliiefskmardpqrylviqgdermhlps
    ptdsnfyralmdeedmddvvdadeylipqqg
    

    Sequence, based on observed residues (ATOM records): (download)
    >5gtyA (A:)
    nqallrilketefkkikvlgsgafgtvykglwipegekvkipvaikelrekankeildea
    yvmasvdnphvcrllgicltstvqlimqlmpfgclldyvrehkdnigsqyllnwcvqiak
    gmnyledrrlvhrdlaarnvlvktpqhvkitdfglakllgkvpikwmalesilhriythq
    sdvwsygvtvwelmtfgskpydgipaseissilekgerlpqppictidvymimvkcwmid
    adsrpkfreliiefskmardpqrylviqgdermhlpsptdsnfyralmdeedmddvvdad
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5gtyB (B:)
    gamggeapnqallrilketefkkikvlgsgafgtvykglwipegekvkipvaikelreat
    spkankeildeayvmasvdnphvcrllgicltstvqlimqlmpfgclldyvrehkdnigs
    qyllnwcvqiakgmnyledrrlvhrdlaarnvlvktpqhvkitdfglakllgaeekeyha
    eggkvpikwmalesilhriythqsdvwsygvtvwelmtfgskpydgipaseissilekge
    rlpqppictidvymimvkcwmidadsrpkfreliiefskmardpqrylviqgdermhlps
    ptdsnfyralmdeedmddvvdadeylipqqg
    

    Sequence, based on observed residues (ATOM records): (download)
    >5gtyB (B:)
    nqallrilketefkkikvlgsgafgtvykglwipegekvkipvaikelrekankeildea
    yvmasvdnphvcrllgicltstvqlimqlmpfgclldyvrehkdnigsqyllnwcvqiak
    gmnyledrrlvhrdlaarnvlvktpqhvkitdfglakllkvpikwmalesilhriythqs
    dvwsygvtvwelmtfgskpydgipaseissilekgerlpqppictidvymimvkcwmida
    dsrpkfreliiefskmardpqrylviqgdermhlpsptdsnfyralmdeedmddvvdad
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5gtyC (C:)
    gamggeapnqallrilketefkkikvlgsgafgtvykglwipegekvkipvaikelreat
    spkankeildeayvmasvdnphvcrllgicltstvqlimqlmpfgclldyvrehkdnigs
    qyllnwcvqiakgmnyledrrlvhrdlaarnvlvktpqhvkitdfglakllgaeekeyha
    eggkvpikwmalesilhriythqsdvwsygvtvwelmtfgskpydgipaseissilekge
    rlpqppictidvymimvkcwmidadsrpkfreliiefskmardpqrylviqgdermhlps
    ptdsnfyralmdeedmddvvdadeylipqqg
    

    Sequence, based on observed residues (ATOM records): (download)
    >5gtyC (C:)
    nqallrilketefkkikvlgsgafgtvykglwipegekvkipvaikelrekankeildea
    yvmasvdnphvcrllgicltstvqlimqlmpfgclldyvrehkdnigsqyllnwcvqiak
    gmnyledrrlvhrdlaarnvlvktpqhvkitdfglaklpikwmalesilhriythqsdvw
    sygvtvwelmtfgskpydgipaseissilekgerlpqppictidvymimvkcwmidadsr
    pkfreliiefskmardpqrylviqgdermhlpsptdsnfyralmdeedmddvvda
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >5gtyD (D:)
    gamggeapnqallrilketefkkikvlgsgafgtvykglwipegekvkipvaikelreat
    spkankeildeayvmasvdnphvcrllgicltstvqlimqlmpfgclldyvrehkdnigs
    qyllnwcvqiakgmnyledrrlvhrdlaarnvlvktpqhvkitdfglakllgaeekeyha
    eggkvpikwmalesilhriythqsdvwsygvtvwelmtfgskpydgipaseissilekge
    rlpqppictidvymimvkcwmidadsrpkfreliiefskmardpqrylviqgdermhlps
    ptdsnfyralmdeedmddvvdadeylipqqg
    

    Sequence, based on observed residues (ATOM records): (download)
    >5gtyD (D:)
    qallrilketefkkikvlgsgafgtvykglwipegekvkipvaikelreankeildeayv
    masvdnphvcrllgicltstvqlimqlmpfgclldyvrehkdnigsqyllnwcvqiakgm
    nyledrrlvhrdlaarnvlvktpqhvkitdfglakllkvpikwmalesilhriythqsdv
    wsygvtvwelmtfgskpydgipaseissilekgerlpqppictidvymimvkcwmidads
    rpkfreliiefskmardpqrylviqgdermhlpsptdsnfyralmdeedmddvvdad
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >5gtyE (E:)
    gamggeapnqallrilketefkkikvlgsgafgtvykglwipegekvkipvaikelreat
    spkankeildeayvmasvdnphvcrllgicltstvqlimqlmpfgclldyvrehkdnigs
    qyllnwcvqiakgmnyledrrlvhrdlaarnvlvktpqhvkitdfglakllgaeekeyha
    eggkvpikwmalesilhriythqsdvwsygvtvwelmtfgskpydgipaseissilekge
    rlpqppictidvymimvkcwmidadsrpkfreliiefskmardpqrylviqgdermhlps
    ptdsnfyralmdeedmddvvdadeylipqqg
    

    Sequence, based on observed residues (ATOM records): (download)
    >5gtyE (E:)
    qallrilketefkkikvlgsgafgtvykglwipegekvkipvaikelreankeildeayv
    masvdnphvcrllgicltstvqlimqlmpfgclldyvrehkdnigsqyllnwcvqiakgm
    nyledrrlvhrdlaarnvlvktpqhvkitdfglakllkvpikwmalesilhriythqsdv
    wsygvtvwelmtfgskpydgipaseissilekgerlpqppictidvymimvkcwmidads
    rpkfreliiefskmardpqrylviqgdermhlpsptdsnfyralmdeedmddvvdad
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >5gtyF (F:)
    gamggeapnqallrilketefkkikvlgsgafgtvykglwipegekvkipvaikelreat
    spkankeildeayvmasvdnphvcrllgicltstvqlimqlmpfgclldyvrehkdnigs
    qyllnwcvqiakgmnyledrrlvhrdlaarnvlvktpqhvkitdfglakllgaeekeyha
    eggkvpikwmalesilhriythqsdvwsygvtvwelmtfgskpydgipaseissilekge
    rlpqppictidvymimvkcwmidadsrpkfreliiefskmardpqrylviqgdermhlps
    ptdsnfyralmdeedmddvvdadeylipqqg
    

    Sequence, based on observed residues (ATOM records): (download)
    >5gtyF (F:)
    nqallrilketefkkikvlgsgafgtvykglwipegekvkipvaikelrekankeildea
    yvmasvdnphvcrllgicltstvqlimqlmpfgclldyvrehkdnigsqyllnwcvqiak
    gmnyledrrlvhrdlaarnvlvktpqhvkitdfglakllvpikwmalesilhriythqsd
    vwsygvtvwelmtfgskpydgipaseissilekgerlpqppictidvymimvkcwmidad
    srpkfreliiefskmardpqrylviqgdermhlpsptdsnfyralmdeedmddvvda
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >5gtyG (G:)
    gamggeapnqallrilketefkkikvlgsgafgtvykglwipegekvkipvaikelreat
    spkankeildeayvmasvdnphvcrllgicltstvqlimqlmpfgclldyvrehkdnigs
    qyllnwcvqiakgmnyledrrlvhrdlaarnvlvktpqhvkitdfglakllgaeekeyha
    eggkvpikwmalesilhriythqsdvwsygvtvwelmtfgskpydgipaseissilekge
    rlpqppictidvymimvkcwmidadsrpkfreliiefskmardpqrylviqgdermhlps
    ptdsnfyralmdeedmddvvdadeylipqqg
    

    Sequence, based on observed residues (ATOM records): (download)
    >5gtyG (G:)
    pnqallrilketefkkikvlgsgafgtvykglwipegekvkipvaikelreankeildea
    yvmasvdnphvcrllgicltstvqlimqlmpfgclldyvrehkdnigsqyllnwcvqiak
    gmnyledrrlvhrdlaarnvlvktpqhvkitdfglakllkvpikwmalesilhriythqs
    dvwsygvtvwelmtfgskpydgipaseissilekgerlpqppictidvymimvkcwmida
    dsrpkfreliiefskmardpqrylviqgdermhlpsptdsnfyralmdeedmddvvdad
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >5gtyH (H:)
    gamggeapnqallrilketefkkikvlgsgafgtvykglwipegekvkipvaikelreat
    spkankeildeayvmasvdnphvcrllgicltstvqlimqlmpfgclldyvrehkdnigs
    qyllnwcvqiakgmnyledrrlvhrdlaarnvlvktpqhvkitdfglakllgaeekeyha
    eggkvpikwmalesilhriythqsdvwsygvtvwelmtfgskpydgipaseissilekge
    rlpqppictidvymimvkcwmidadsrpkfreliiefskmardpqrylviqgdermhlps
    ptdsnfyralmdeedmddvvdadeylipqqg
    

    Sequence, based on observed residues (ATOM records): (download)
    >5gtyH (H:)
    nqallrilketefkkikvlgsgafgtvykglwipegekvkipvaikelreaankeildea
    yvmasvdnphvcrllgicltstvqlimqlmpfgclldyvrehkdnigsqyllnwcvqiak
    gmnyledrrlvhrdlaarnvlvktpqhvkitdfglakllkvpikwmalesilhriythqs
    dvwsygvtvwelmtfgskpydgipaseissilekgerlpqppictidvymimvkcwmida
    dsrpkfreliiefskmardpqrylviqgdermhlpsptdsnfyralmdeedmddvvadey