PDB entry 5gtx

View 5gtx on RCSB PDB site
Description: crystal structure of mutated buckwheat glutaredoxin
Deposited on 2016-08-23, released 2017-07-05
The last revision was dated 2017-09-27, with a file datestamp of 2017-09-22.
Experiment type: XRAY
Resolution: 2.28 Å
R-factor: N/A
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: buckwheat glutaredoxin
    Species: Polygonaceae [TaxId:3615]
    Database cross-references and differences (RAF-indexed):
    • PDB 5GTX
  • Chain 'B':
    Compound: buckwheat glutaredoxin
    Species: Polygonaceae [TaxId:3615]
    Database cross-references and differences (RAF-indexed):
    • PDB 5GTX
  • Heterogens: HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >5gtxA (A:)
    gplgsmgsvlssgqpteeqlkmalqkaqqlvnsnplvvfsktyagycsrvkklfdqlgar
    yqtieldqesdgdaiqaallqwtgqrtvpnvfiggkhiggcdsvmekhrdgklvpmltec
    gaiaiesta
    

    Sequence, based on observed residues (ATOM records):
    >5gtxA (A:)
    pteeqlkmalqkaqqlvnsnplvvfsktyagycsrvkklfdqlgaryqtieldqesdgda
    iqaallqwtgqrtvpnvfiggkhiggcdsvmekhrdgklvpmltecgaia
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >5gtxB (B:)
    gplgsmgsvlssgqpteeqlkmalqkaqqlvnsnplvvfsktyagycsrvkklfdqlgar
    yqtieldqesdgdaiqaallqwtgqrtvpnvfiggkhiggcdsvmekhrdgklvpmltec
    gaiaiesta
    

    Sequence, based on observed residues (ATOM records):
    >5gtxB (B:)
    pteeqlkmalqkaqqlvnsnplvvfsktyagycsrvkklfdqlgaryqtieldqesdgda
    iqaallqwtgqrtvpnvfiggkhiggcdsvmekhrdgklvpmltecgaia