PDB entry 5gtv

View 5gtv on RCSB PDB site
Description: the n253f mutant structure of trehalose synthase from deinococcus radiodurans reveals an open active-site conformation
Deposited on 2016-08-23, released 2017-08-30
Made obsolete by 5ykb on 2017-10-25

The last revision was dated 2017-10-25, with a file datestamp of 2017-10-20.
Experiment type: XRAY
Resolution: 2.85 Å
R-factor: N/A
AEROSPACI score: 0.15 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Trehalose synthase
    Species: Deinococcus radiodurans R1 [TaxId:243230]
    Database cross-references and differences (RAF-indexed):
    • Uniprot I3NX86 (Start-553)
      • engineered mutation (98)
      • engineered mutation (254)
      • engineered mutation (314)
      • engineered mutation (381)
  • Chain 'B':
    Compound: Trehalose synthase
    Species: Deinococcus radiodurans R1 [TaxId:243230]
    Database cross-references and differences (RAF-indexed):
    • Uniprot I3NX86 (Start-553)
      • engineered mutation (98)
      • engineered mutation (254)
      • engineered mutation (314)
      • engineered mutation (381)
  • Chain 'C':
    Compound: Trehalose synthase
    Species: Deinococcus radiodurans R1 [TaxId:243230]
    Database cross-references and differences (RAF-indexed):
    • Uniprot I3NX86 (Start-553)
      • engineered mutation (98)
      • engineered mutation (254)
      • engineered mutation (314)
      • engineered mutation (381)
  • Chain 'D':
    Compound: Trehalose synthase
    Species: Deinococcus radiodurans R1 [TaxId:243230]
    Database cross-references and differences (RAF-indexed):
    • Uniprot I3NX86 (Start-553)
      • engineered mutation (98)
      • engineered mutation (254)
      • engineered mutation (314)
      • engineered mutation (381)
  • Heterogens: CA, MG, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >5gtvA (A:)
    mvptqahpewyksavfyelsvrtfqdgngdgkgdfpgltsrldylknlgvdclwllpwfp
    splrddgydvadyrgihpdlgtlddfkvflreaharglwvigdlvtnhtssdhpwfqaar
    rgptlpdgspneyhdyyvwsdegkeyadtriiftdtevsnwtldeqagkyywhrffasqp
    dlnydnpkvveelhgaarfwldlgldgfrvdavpylieregtscenlpetheilkgfram
    vdreypgrlllaeafqwpeevveyfgteaepefhmcfnfpvmprlymslkredtssirei
    mgrlpkipsfgqwciflrnhdeltlemvtdderafmyaayapdarmkinvgirrrlapll
    dndrrriellntvllalpgspvlyygdeigmgddlglpdrngvrtpmqwnagtsggfsta
    qpsdcffppiqdpvygfgrvnvqsqlqdpssllkwtarqlelrrahpafahgdltfietg
    npailaftrqydgetllivsnfagnaqaglldlapfvgrapvtlsgasplpvvtgngqyp
    vvmgkydyywlrlnsrvdklaaalehhhhhh
    

    Sequence, based on observed residues (ATOM records):
    >5gtvA (A:)
    pewyksavfyelsvrtfqdgngdgkgdfpgltsrldylknlgvdclwllpwfpsplrddg
    ydvadyrgihpdlgtlddfkvflreaharglwvigdlvtnhtssdhpwfqaarrgptlpd
    gspneyhdyyvwnwtldeqagkyywhrffasqpdlnydnpkvveelhgaarfwldlgldg
    frvdavpylieregtscenlpetheilkgframvdreypgrlllaeafqwpeevveyfgt
    eaepefhmcfnfpvmprlymslkredtssireimgrlpkipsfgqwciflrnhdeltlem
    vtdderafmyaayapdarmkinvgirrrlaplldndrrriellntvllalpgspvlyygd
    eigmgddlglpdrngvrtpmqwnagtsggfstaqpsdcffppiqdpvygfgrvnvqsqlq
    dpssllkwtarqlelrrahpafahgdltfietgnpailaftrqydgetllivsnfagnaq
    aglldlapfvgrapvtlsgasplpvvtgngqypvvmgkydyywlrln
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >5gtvB (B:)
    mvptqahpewyksavfyelsvrtfqdgngdgkgdfpgltsrldylknlgvdclwllpwfp
    splrddgydvadyrgihpdlgtlddfkvflreaharglwvigdlvtnhtssdhpwfqaar
    rgptlpdgspneyhdyyvwsdegkeyadtriiftdtevsnwtldeqagkyywhrffasqp
    dlnydnpkvveelhgaarfwldlgldgfrvdavpylieregtscenlpetheilkgfram
    vdreypgrlllaeafqwpeevveyfgteaepefhmcfnfpvmprlymslkredtssirei
    mgrlpkipsfgqwciflrnhdeltlemvtdderafmyaayapdarmkinvgirrrlapll
    dndrrriellntvllalpgspvlyygdeigmgddlglpdrngvrtpmqwnagtsggfsta
    qpsdcffppiqdpvygfgrvnvqsqlqdpssllkwtarqlelrrahpafahgdltfietg
    npailaftrqydgetllivsnfagnaqaglldlapfvgrapvtlsgasplpvvtgngqyp
    vvmgkydyywlrlnsrvdklaaalehhhhhh
    

    Sequence, based on observed residues (ATOM records):
    >5gtvB (B:)
    pewyksavfyelsvrtfqdgngdgkgdfpgltsrldylknlgvdclwllpwfpsplrddg
    ydvadyrgihpdlgtlddfkvflreaharglwvigdlvtnhtssdhpwfqaarrgptlpd
    gspneyhdyyvwnwtldeqagkyywhrffasqpdlnydnpkvveelhgaarfwldlgldg
    frvdavpylieregtscenlpetheilkgframvdreypgrlllaeafqwpeevveyfgt
    eaepefhmcfnfpvmprlymslkredtssireimgrlpkipsfgqwciflrnhdeltlem
    vtdderafmyaayapdarmkinvgirrrlaplldndrrriellntvllalpgspvlyygd
    eigmgddlglpdrngvrtpmqwnagtsggfstaqpsdcffppiqdpvygfgrvnvqsqlq
    dpssllkwtarqlelrrahpafahgdltfietgnpailaftrqydgetllivsnfagnaq
    aglldlapfvgrapvtlsgasplpvvtgngqypvvmgkydyywlrln
    

  • Chain 'C':
    Sequence, based on SEQRES records:
    >5gtvC (C:)
    mvptqahpewyksavfyelsvrtfqdgngdgkgdfpgltsrldylknlgvdclwllpwfp
    splrddgydvadyrgihpdlgtlddfkvflreaharglwvigdlvtnhtssdhpwfqaar
    rgptlpdgspneyhdyyvwsdegkeyadtriiftdtevsnwtldeqagkyywhrffasqp
    dlnydnpkvveelhgaarfwldlgldgfrvdavpylieregtscenlpetheilkgfram
    vdreypgrlllaeafqwpeevveyfgteaepefhmcfnfpvmprlymslkredtssirei
    mgrlpkipsfgqwciflrnhdeltlemvtdderafmyaayapdarmkinvgirrrlapll
    dndrrriellntvllalpgspvlyygdeigmgddlglpdrngvrtpmqwnagtsggfsta
    qpsdcffppiqdpvygfgrvnvqsqlqdpssllkwtarqlelrrahpafahgdltfietg
    npailaftrqydgetllivsnfagnaqaglldlapfvgrapvtlsgasplpvvtgngqyp
    vvmgkydyywlrlnsrvdklaaalehhhhhh
    

    Sequence, based on observed residues (ATOM records):
    >5gtvC (C:)
    pewyksavfyelsvrtfqdgngdgkgdfpgltsrldylknlgvdclwllpwfpsplrddg
    ydvadyrgihpdlgtlddfkvflreaharglwvigdlvtnhtssdhpwfqaarrgptlpd
    gspneyhdyyvwnwtldeqagkyywhrffasqpdlnydnpkvveelhgaarfwldlgldg
    frvdavpylieregtscenlpetheilkgframvdreypgrlllaeafqwpeevveyfgt
    eaepefhmcfnfpvmprlymslkredtssireimgrlpkipsfgqwciflrnhdeltlem
    vtdderafmyaayapdarmkinvgirrrlaplldndrrriellntvllalpgspvlyygd
    eigmgddlglpdrngvrtpmqwnagtsggfstaqpsdcffppiqdpvygfgrvnvqsqlq
    dpssllkwtarqlelrrahpafahgdltfietgnpailaftrqydgetllivsnfagnaq
    aglldlapfvgrapvtlsgasplpvvtgngqypvvmgkydyywlrln
    

  • Chain 'D':
    Sequence, based on SEQRES records:
    >5gtvD (D:)
    mvptqahpewyksavfyelsvrtfqdgngdgkgdfpgltsrldylknlgvdclwllpwfp
    splrddgydvadyrgihpdlgtlddfkvflreaharglwvigdlvtnhtssdhpwfqaar
    rgptlpdgspneyhdyyvwsdegkeyadtriiftdtevsnwtldeqagkyywhrffasqp
    dlnydnpkvveelhgaarfwldlgldgfrvdavpylieregtscenlpetheilkgfram
    vdreypgrlllaeafqwpeevveyfgteaepefhmcfnfpvmprlymslkredtssirei
    mgrlpkipsfgqwciflrnhdeltlemvtdderafmyaayapdarmkinvgirrrlapll
    dndrrriellntvllalpgspvlyygdeigmgddlglpdrngvrtpmqwnagtsggfsta
    qpsdcffppiqdpvygfgrvnvqsqlqdpssllkwtarqlelrrahpafahgdltfietg
    npailaftrqydgetllivsnfagnaqaglldlapfvgrapvtlsgasplpvvtgngqyp
    vvmgkydyywlrlnsrvdklaaalehhhhhh
    

    Sequence, based on observed residues (ATOM records):
    >5gtvD (D:)
    pewyksavfyelsvrtfqdgngdgkgdfpgltsrldylknlgvdclwllpwfpsplrddg
    ydvadyrgihpdlgtlddfkvflreaharglwvigdlvtnhtssdhpwfqaarrgptlpd
    gspneyhdyyvwsdegnwtldeqagkyywhrffasqpdlnydnpkvveelhgaarfwldl
    gldgfrvdavpylieregtscenlpetheilkgframvdreypgrlllaeafqwpeevve
    yfgteaepefhmcfnfpvmprlymslkredtssireimgrlpkipsfgqwciflrnhdel
    tlemvtdderafmyaayapdarmkinvgirrrlaplldndrrriellntvllalpgspvl
    yygdeigmgddlglpdrngvrtpmqwnagtsggfstaqpsdcffppiqdpvygfgrvnvq
    sqlqdpssllkwtarqlelrrahpafahgdltfietgnpailaftrqydgetllivsnfa
    gnaqaglldlapfvgrapvtlsgasplpvvtgngqypvvmgkydyywlrln