PDB entry 5gtt

View 5gtt on RCSB PDB site
Description: Crystal structure of C. perfringens iota-like enterotoxin CPILE-a
Class: toxin
Keywords: bacterial toxin, actin, CPILE-a, ADP-ribosylation, TOXIN
Deposited on 2016-08-23, released 2017-03-01
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-03-01, with a file datestamp of 2017-02-24.
Experiment type: XRAY
Resolution: 2.01 Å
R-factor: N/A
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Binary enterotoxin of Clostridium perfringens component a
    Species: Clostridium perfringens [TaxId:1502]
    Gene: becA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5gtta1, d5gtta2
  • Heterogens: EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5gttA (A:)
    gsmlddnrpmdfakdknsatlwakkrkqvwlnnlskaestsinnyiknsseinsysikkk
    faldnyegietlnedlknistavkksmltkplyvyyyeandkfgfnqnlessldsniide
    eainnfakkisdtnfiqdgfkdvtmtepdinsklpilvhlklptntpaasygndeenlrv
    lidqgyslkatglsivtikgkqyakvdadlikqlnfendvisasqwgeenyapwlkelts
    nelrdinnylgggytainkylldgtigentskedleekisnissalkkrkipediityrr
    mgpnefgldlnspdydfnkvenvskfkekwlgktipvktfisttvlsnnisafakrklil
    rlhlpngsnaayvsvaegykneyevlidhgysykidniteyydesslggktnkliidatl
    i
    

    Sequence, based on observed residues (ATOM records): (download)
    >5gttA (A:)
    ddnrpmdfakdknsatlwakkrkqvwlnnlskaestsinnyiknsseinsysikkkfald
    nyegietlnedlknistavkksmltkplyvyyyeandkfgfnqnlessldsniideeain
    nfakkisdtnfiqdgfkdvtmtepdinsklpilvhlklptntpaasygndeenlrvlidq
    gyslkatglsivtikgkqyakvdadlikqlnfendvisasqwgeenyapwlkeltsnelr
    dinnylgggytainkylldgtigentskedleekisnissalkkrkipediityrrmgpn
    efgldlnspdydfnkvenvskfkekwlgktipvktfisttvlsnnisafakrklilrlhl
    pngsnaayvsvaegykneyevlidhgysykidniteyydesslggktnkliidatli