PDB entry 5gtr

View 5gtr on RCSB PDB site
Description: estrogen receptor alpha in complex with a stabilized peptide antagonist 6
Deposited on 2016-08-23, released 2017-08-30
The last revision was dated 2017-12-20, with a file datestamp of 2017-12-15.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: N/A
AEROSPACI score: 0.14 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Estrogen receptor
    Species: Homo sapiens [TaxId:9606]
    Gene: ESR1, ESR, NR3A1
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: arg-ias-ile-0jy-dpp-arg-0jy-0jy-gln-nh2
    Species: UNIDENTIFIED, synthetic [TaxId:32644]
    Database cross-references and differences (RAF-indexed):
    • PDB 5GTR (0-End)
  • Heterogens: EST

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >5gtrA (A:)
    slalsltadqmvsalldaeppilyseydptrpfseasmmglltnladrelvhminwakrv
    pgfvdltlhdqvhllecawleilmiglvwrsmehpgkllfapnllldrnqgkcvegmvei
    fdmllatssrfrmmnlqgeefvclksiillnsgvytflsstlksleekdhihrvldkitd
    tlihlmakagltlqqqhqrlaqlllilshirhmsnkgmehlysmkcknvvplydllleml
    dah
    

    Sequence, based on observed residues (ATOM records):
    >5gtrA (A:)
    slalsltadqmvsalldaeppilyseseasmmglltnladrelvhminwakrvpgfvdlt
    lhdqvhllecawleilmiglvwrsmehpgkllfapnllldrnqgkcvegmveifdmllat
    ssrfrmmnlqgeefvclksiillnsgvytflsstlksleekdhihrvldkitdtlihlma
    kagltlqqqhqrlaqlllilshirhmsnkgmehlysmkcknvvplydlllemldah
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records:
    >5gtrC (C:)
    rdixarxxq