PDB entry 5gtq

View 5gtq on RCSB PDB site
Description: Luciferin-regenerating enzyme at cryogenic temperature
Class: hydrolase
Keywords: beta-prooeller, hydrolase
Deposited on 2016-08-23, released 2016-11-09
The last revision prior to the SCOPe 2.07 freeze date was dated 2016-11-09, with a file datestamp of 2016-11-04.
Experiment type: XRAY
Resolution: 1.13 Å
R-factor: N/A
AEROSPACI score: 0.7 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Luciferin regenerating enzyme
    Species: Photinus pyralis [TaxId:7054]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q95YI4 (Start-310)
      • see sequence details (135)
      • see sequence details (270)
      • see sequence details (283)
    Domains in SCOPe 2.07: d5gtqa_
  • Heterogens: HG, MG, MPD, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5gtqA (A:)
    gshmgpvvekiaelgkytvgegphwdhetqtlyfvdtvektfhkyvpsqkkytfckvdkl
    vsfiiplagspgrfvvslereiailtwdgvsaaptsieaivnvephiknnrlndgkadpl
    gnlwtgtmaidaglpigpvtgslyhlgadkkvkmhesniaianglawsndlkkmyyidsg
    krrvdeydydastlsisnqrplftfekhevpgypdgqtideegnlwvavfqgqriikist
    qqpevlldtvkipdpqvtsvafggpnldelyvtsaglqlddssfdkslvnghvyrvtglg
    vkgfagvkvkl
    

    Sequence, based on observed residues (ATOM records): (download)
    >5gtqA (A:)
    gpvvekiaelgkytvgegphwdhetqtlyfvdtvektfhkyvpsqkkytfckvdklvsfi
    iplagspgrfvvslereiailtwdgvsaaptsieaivnvephiknnrlndgkadplgnlw
    tgtmaidaglpigpvtgslyhlgadkkvkmhesniaianglawsndlkkmyyidsgkrrv
    deydydastlsisnqrplftfekhevpgypdgqtideegnlwvavfqgqriikistqqpe
    vlldtvkipdpqvtsvafggpnldelyvtsaglqlddssfdkslvnghvyrvtglgvkgf
    agvkvkl