PDB entry 5gtd

View 5gtd on RCSB PDB site
Description: o-Succinylbenzoate CoA Synthetase (MenE) from Bacillus Subtilis in Complex with the Acyl-adenylate Intermediate OSB-AMP
Class: ligase
Keywords: Adenylate-forming Enzyme, adenylate intermdiate, OSBAMP, in-line backside nucleophilic substitution, strained conformation, LIGASE
Deposited on 2016-08-20, released 2017-01-04
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-01-04, with a file datestamp of 2016-12-30.
Experiment type: XRAY
Resolution: 2.69 Å
R-factor: N/A
AEROSPACI score: 0.18 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 2-succinylbenzoate--CoA ligase
    Species: Bacillus subtilis (strain 168) [TaxId:224308]
    Gene: menE, BSU30790
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5gtda_
  • Chain 'B':
    Compound: 2-succinylbenzoate--CoA ligase
    Species: Bacillus subtilis (strain 168) [TaxId:224308]
    Gene: menE, BSU30790
    Database cross-references and differences (RAF-indexed):
  • Heterogens: CL, PEG, A, OSB, MG, IMD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5gtdA (A:)
    mgmlteqpnwlmqraqltperialiyedqtvtfaelfaaskrmaeqlaahsvrkgdtaai
    llqnraemvyavhacfllgvkavllntklstherlfqledsgsgflltdssfekkeyehi
    vqtidvdelmkeaaeeieieaymqmdatatlmytsgttgkpkgvqqtfgnhyfsavssal
    nlgiteqdrwlialplfhisglsalfksviygmtvvlhqrfsvsdvlhsinrhevtmisa
    vqtmlaslleetnrcpesircillgggpaplplleecrekgfpvfqsygmtetcsqivtl
    spefsmeklgsagkplfsceikierdgqvcepyehgeimvkgpnvmksyfnresaneasf
    qngwlktgdlgyldnegflyvldrrsdliisggeniypaevesvllshpavaeagvsgae
    dkkwgkvphaylvlhkpvsageltdyckerlakykipakffvldrlprnasnkllrnqlk
    darkgellhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5gtdA (A:)
    lteqpnwlmqraqltperialiyedqtvtfaelfaaskrmaeqlaahsvrkgdtaaillq
    nraemvyavhacfllgvkavllntklstherlfqledsgsgflltdssfekkeyehivqt
    idvdelmkeaaeeieieaymqmdatatlmytsgttgkpkgvqqtfgnhyfsavssalnlg
    iteqdrwlialplfhisglsalfksviygmtvvlhqrfsvsdvlhsinrhevtmisavqt
    mlaslleetnrcpesircillgggpaplplleecrekgfpvfqsygmtetcsqivtlspe
    fsmeklgsagkplfsceikierdgqvcepyehgeimvkgpnvmksyfnresaneasfqng
    wlktgdlgyldnegflyvldrrsdliisggeniypaevesvllshpavaeagvsgaedkk
    wgkvphaylvlhkpvsageltdyckerlakykipakffvldrlprnasnkllrnqlkdar
    kgel
    

  • Chain 'B':
    No sequence available.