PDB entry 5gt1

View 5gt1 on RCSB PDB site
Description: crystal structure of cbpa from l. salivarius ren
Deposited on 2016-08-18, released 2017-07-19
The last revision was dated 2017-10-18, with a file datestamp of 2017-10-13.
Experiment type: XRAY
Resolution: 1.85 Å
R-factor: N/A
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: choline binding protein a
    Species: Lactobacillus salivarius str. Ren [TaxId:1194971]
    Gene: LsR_01470
    Database cross-references and differences (RAF-indexed):
  • Heterogens: ZN, ACT, EDO, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >5gt1A (A:)
    mgsshhhhhssgenlyfqggskdtwgwpfpsvgegyfsgaqlfgvnpggefrmngfhdgl
    dfgsidhpgsavhavhsgvvtqigyiaglenyvvvrsdeytfvyqeafsnkgnisvkvgq
    qintgdvigyrdtshlhlgitretnvmkaiansfnnngtwldpralikngianq
    

    Sequence, based on observed residues (ATOM records):
    >5gt1A (A:)
    kdtwgwpfpsvgegyfsgaqlfgvnpggefrmngfhdgldfgsidhpgsavhavhsgvvt
    qigyiaglenyvvvrsdeytfvyqeafsnkgnisvkvgqqintgdvigyrdtshlhlgit
    retnvmkaiansfnnngtwldpralikngianq