PDB entry 5gsq

View 5gsq on RCSB PDB site
Description: Crystal structure of IgG Fc with a homogeneous glycoform and Antibody-Dependent Cellular Cytotoxicity
Class: immune system
Keywords: Antibody Fc, homogeneous N-glycan, enhanced ADCC, di-sialylation, IMMUNE SYSTEM
Deposited on 2016-08-17, released 2017-06-28
The last revision prior to the SCOPe 2.06 freeze date was dated 2017-06-28, with a file datestamp of 2017-06-23.
Experiment type: XRAY
Resolution: 1.85 Å
R-factor: N/A
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ig gamma-1 chain C region
    Species: Homo sapiens [TaxId:9606]
    Gene: IGHG1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5gsqa1, d5gsqa2
  • Chain 'B':
    Compound: Ig gamma-1 chain C region
    Species: Homo sapiens [TaxId:9606]
    Gene: IGHG1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5gsqb1, d5gsqb2
  • Chain 'C':
    Compound: Ig gamma-1 chain C region
    Species: Homo sapiens [TaxId:9606]
    Gene: IGHG1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5gsqc1, d5gsqc2
  • Chain 'D':
    Compound: Ig gamma-1 chain C region
    Species: Homo sapiens [TaxId:9606]
    Gene: IGHG1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5gsqd1, d5gsqd2
  • Heterogens: NAG, BMA, MAN, GAL, SIA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5gsqA (A:)
    thtcppcpapellggpsvflfppkpkdtlmisrtpevtcvvvdvshedpevkfnwyvdgv
    evhnaktkpreeqynstyrvvsvltvlhqdwlngkeykckvsnkalpapiektiskakgq
    prepqvytlppsrdeltknqvsltclvkgfypsdiavewesngqpennykttppvldsdg
    sfflyskltvdksrwqqgnvfscsvmhealhnhytqkslslspgk
    

    Sequence, based on observed residues (ATOM records): (download)
    >5gsqA (A:)
    gpsvflfppkpkdtlmisrtpevtcvvvdvshedpevkfnwyvdgvevhnaktkpreeqy
    nstyrvvsvltvlhqdwlngkeykckvsnkalpapiektiskakgqprepqvytlppsrd
    eltknqvsltclvkgfypsdiavewesngqpennykttppvldsdgsfflyskltvdksr
    wqqgnvfscsvmhealhnhytqkslsls
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5gsqB (B:)
    thtcppcpapellggpsvflfppkpkdtlmisrtpevtcvvvdvshedpevkfnwyvdgv
    evhnaktkpreeqynstyrvvsvltvlhqdwlngkeykckvsnkalpapiektiskakgq
    prepqvytlppsrdeltknqvsltclvkgfypsdiavewesngqpennykttppvldsdg
    sfflyskltvdksrwqqgnvfscsvmhealhnhytqkslslspgk
    

    Sequence, based on observed residues (ATOM records): (download)
    >5gsqB (B:)
    gpsvflfppkpkdtlmisrtpevtcvvvdvshedpevkfnwyvdgvevhnaktkpreeqy
    nstyrvvsvltvlhqdwlngkeykckvsnkalpapiektiskakgqprepqvytlppsrd
    eltknqvsltclvkgfypsdiavewesngqpennykttppvldsdgsfflyskltvdksr
    wqqgnvfscsvmhealhnhytqkslsls
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5gsqC (C:)
    thtcppcpapellggpsvflfppkpkdtlmisrtpevtcvvvdvshedpevkfnwyvdgv
    evhnaktkpreeqynstyrvvsvltvlhqdwlngkeykckvsnkalpapiektiskakgq
    prepqvytlppsrdeltknqvsltclvkgfypsdiavewesngqpennykttppvldsdg
    sfflyskltvdksrwqqgnvfscsvmhealhnhytqkslslspgk
    

    Sequence, based on observed residues (ATOM records): (download)
    >5gsqC (C:)
    gpsvflfppkpkdtlmisrtpevtcvvvdvshedpevkfnwyvdgvevhnaktkpreeqy
    nstyrvvsvltvlhqdwlngkeykckvsnkalpapiektiskakgqprepqvytlppsrd
    eltknqvsltclvkgfypsdiavewesngqpennykttppvldsdgsfflyskltvdksr
    wqqgnvfscsvmhealhnhytqkslsls
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >5gsqD (D:)
    thtcppcpapellggpsvflfppkpkdtlmisrtpevtcvvvdvshedpevkfnwyvdgv
    evhnaktkpreeqynstyrvvsvltvlhqdwlngkeykckvsnkalpapiektiskakgq
    prepqvytlppsrdeltknqvsltclvkgfypsdiavewesngqpennykttppvldsdg
    sfflyskltvdksrwqqgnvfscsvmhealhnhytqkslslspgk
    

    Sequence, based on observed residues (ATOM records): (download)
    >5gsqD (D:)
    vflfppkpkdtlmisrtpevtcvvvddpevkfnwyvdgvevhnaktkprenstyrvvsvl
    tvlhqdwlngkeykckvspapiektiskakgqprepqvytlppsrdeltknqvsltclvk
    gfypsdiavewesngqpennykttppvldsdgsfflyskltvdksrwqqgnvfscsvmhe
    alhnhytqkslsls