PDB entry 5gs8

View 5gs8 on RCSB PDB site
Description: Crystal structure of TLA-3 extended-spectrum beta-lactamase
Class: hydrolase
Keywords: extended-spectrum beta-lactamase, HYDROLASE
Deposited on 2016-08-14, released 2017-07-12
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-07-12, with a file datestamp of 2017-07-07.
Experiment type: XRAY
Resolution: 1.59 Å
R-factor: N/A
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Beta-lactamase
    Species: Serratia marcescens [TaxId:615]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5gs8a_
  • Heterogens: SO4, NA, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5gs8A (A:)
    akgtdslknsiekylkdkkakvgvavlgiednfklnvnekhhypmqstykfhlalavldk
    ldkenisvdkklfvkksdlqpntwsplkdkypngnlelsfseiikstvshsdnngcdilf
    rfvggtnkvhnfisklgvknisikateeemhkawnvqytnwttpdatvqllkkfykneil
    sknsydfllntmietttgpkrlkgllpdgtvvahktgssdtnnkgitaatndigiitlpn
    gkhfaiavyvsdsseksdvnekiiaeicksvwdylvkdgk
    

    Sequence, based on observed residues (ATOM records): (download)
    >5gs8A (A:)
    gtdslknsiekylkdkkakvgvavlgiednfklnvnekhhypmqstykfhlalavldkld
    kenisvdkklfvkksdlqpntwsplkdkypngnlelsfseiikstvshsdnngcdilfrf
    vggtnkvhnfisklgvknisikateeemhkawnvqytnwttpdatvqllkkfykneilsk
    nsydfllntmietttgpkrlkgllpdgtvvahktgssdtnnkgitaatndigiitlpngk
    hfaiavyvsdsseksdvnekiiaeicksvwdylvk